KEGG   Auricularia subglabra: AURDEDRAFT_61187Help
Entry
AURDEDRAFT_61187  CDS       T03129                                 

Definition
(GenBank) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
adl  Auricularia subglabra
Pathway
adl00052  Galactose metabolism
adl00500  Starch and sucrose metabolism
adl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AURDEDRAFT_61187
   00500 Starch and sucrose metabolism
    AURDEDRAFT_61187
Enzymes [BR:adl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     AURDEDRAFT_61187
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-ProteinID: EJD48260
JGI: 61187
LinkDB All DBs
AA seq 850 aa AA seqDB search
MALKALLTFALLAQSVAAAVDPKLANCPGYKAENVVVSELAITADVNIAGKACNAYSRDL
NNLRLVVQYQTKDRIRVRLTDQGNNIYQVHDSVFPKPKNNNVYENRHALKFHLVNEPFSF
AVSRKDTGEVLFNTTGQQLVYETQYVRLRTSLPADANLYGFGEHSDSFRLGTKGYRRTFW
NAESPFLPRKGNLYGSHPVYFDHRGKSTHGVFLLNAAGMDINIDQDEGGQYLEYNTLGGV
IDLYIVAGPTPVDVSKQYADIAGLPAMQPYWTFGFHQCKYGWKNIDTYNEVVRNYSAAGI
PLEVLWGDIDYMKNRADFTTDPVNFPLDRFRALIADLHAKKQHMVMMLDPGLLRDPAYEP
YARGIAAGAFLKANDGSDYIGGQWAGTTVFPDWFAPGARDWWVDEILRFFNPDSGIDVDG
LWNDMNEVSNFCREDRCPVAQVHPPSVRPPDGLALGLAEFRDLVYPNYKIHNHRGNLSHQ
TLSTNVTQWDGSVQYDTHNLYGNAMVSATRTALLKRRPGVRPFVLTRSNFAGLGRLGAHW
FGDNNSTWSDYRVQLPQMLAYAAIHQVPMVGSDVCGFNGRADEFMCQRWTMLGALSPFYR
NHADISAPAQEFYRWPSVAATARKAIAMRYRLIDYLYTHMRRQSVTGEPAIKPLFFAYPT
DANTFPIDMQYFFGDSILVSPVTADMSQDVTFYLPNDLFYDFWTGARVQGEGKPVTRTGV
AWDDLPLHIRGGSIIPLRIESAMTTAELRTKGFHLVIAPGKNGQAKGTLYLDDGESIDVG
SNYNEINFHWNGLFLTSSGKFGSKFQPRIQSITFAGKNGWVGANPWKAGKTADASYPLDA
PIKVSLPQSS
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atggctctcaaagcgcttctgacttttgccttgctggcccagtccgtcgccgctgcggtc
gatcccaagcttgccaactgccccgggtacaaggccgagaatgtcgtcgtctccgagctg
gccatcacggccgacgtcaacatcgctggcaaggcctgcaacgcgtacagccgcgaccta
aacaatctccgcctcgtcgtccagtaccagaccaaggaccgcatcagggttcgtttgacg
gaccagggcaacaacatctaccaggtgcacgactccgtcttccccaagcccaagaacaac
aacgtctacgagaaccggcacgcgctcaagttccacctcgtcaacgagcccttctcgttc
gccgtgtcgcgcaaggacaccggcgaggtgctcttcaacaccaccggccagcagctcgtc
tatgagacgcagtatgtgcgcctgcgcacctcgctgcccgcggacgcgaacctctacggc
ttcggcgagcacagcgactcgttccgcctcggcacgaagggctaccgccgcacgttctgg
aacgccgagtcgccgttcctgccgcgcaaaggcaacctctacggctcgcaccccgtctac
ttcgaccaccgcggcaagtcgacccatggcgtcttcctcctcaacgccgccggcatggac
atcaacatcgaccaggacgagggcggccagtacctcgagtacaacactctcggcggcgtc
atcgacctgtacatcgtcgccggcccgacgcccgtggacgtcagcaagcagtacgcggac
atcgcaggcctgccggcgatgcagccatactggacgttcggcttccaccagtgcaagtac
ggctggaagaacatcgacacgtacaacgaggtcgtgcgcaactactcggccgcgggcatc
ccgctcgaggtgctctggggcgacatcgactacatgaagaaccgcgcggacttcacgacg
gaccccgtcaacttcccgctcgaccgcttccgcgcgctcatcgcggacctgcacgcgaag
aagcagcacatggtcatgatgctcgacccgggcctgctgcgcgacccggcgtacgagccg
tacgcgcgcggcatcgccgccggcgcgttcctcaaggcgaacgacggctcggactacatc
ggcgggcagtgggcgggcacgacggtgttcccggactggttcgcgccgggcgcgcgcgac
tggtgggtcgacgagatcctgcgcttcttcaacccggactcgggcatcgacgtcgacggc
ctctggaacgacatgaacgaggtctcgaacttctgccgcgaggaccggtgccccgtcgcg
caggtgcacccgcccagcgtcaggccgcccgacggcctcgcgctcggcctcgccgagttc
cgcgacctcgtgtaccccaactacaaaatccacaaccaccgcggaaacctcagccaccag
acgctctccacgaacgtcacccagtgggatggctcggtgcagtacgacacccacaacttg
tacggtaatgcgatggtcagcgcgacccgcactgccctcctcaagcgccgccccggcgtc
cgccccttcgtcctgacccgcagcaacttcgctggcctcggccgcctcggcgctcactgg
ttcggcgacaacaactcgacctggtccgactaccgcgtgcaactcccgcagatgcttgcg
tacgccgcgatccaccaggtgcccatggtcggctcggacgtgtgcgggttcaacggccgg
gcggacgagttcatgtgccagcgctggacgatgctcggcgcgctctcgcccttctaccgc
aaccacgcggacatcagcgcgcccgcccaggagttctaccgctggccgtccgtcgcggcg
accgcgcgcaaggcgatcgcgatgcgctaccggctcatcgactacctctacacgcacatg
cgccgccagtcggtgacgggcgagccggccatcaagccgctgttcttcgcgtacccaacg
gacgcgaacacgttcccgatcgacatgcagtatttcttcggcgactcgatcctcgtgtcg
cccgtgacggcggacatgtcgcaggacgtgacgttctacctcccgaacgacctcttctac
gacttctggaccggcgcgcgcgtgcagggcgagggcaagccggtgacgcgtaccggcgtc
gcgtgggacgacctcccgctgcacatccgcggcggcagcatcatcccgctgcgcattgag
tcggcgatgacgacggcagagctgcgcacgaagggcttccatctggtgatcgcgccgggc
aagaatggccaggcgaagggcacgctctacctcgacgacggcgagagcatcgacgtcggc
agcaactacaacgagatcaacttccactggaacggcctcttcctcacgtcgagcggcaag
ttcggctccaagttccagcctcgcatccagtccatcaccttcgcgggcaagaacggctgg
gtgggtgccaacccctggaaggcaggcaagacggccgacgcctcctacccgctcgacgcg
ccaatcaaggtctccctccctcagtcgtcgtaa

DBGET integrated database retrieval system