KEGG   Auricularia subglabra: AURDEDRAFT_82231Help
Entry
AURDEDRAFT_82231  CDS       T03129                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
adl  Auricularia subglabra
Pathway
adl03030  DNA replication
adl03410  Base excision repair
adl03420  Nucleotide excision repair
adl03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:adl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AURDEDRAFT_82231
   03410 Base excision repair
    AURDEDRAFT_82231
   03420 Nucleotide excision repair
    AURDEDRAFT_82231
   03430 Mismatch repair
    AURDEDRAFT_82231
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:adl03032]
    AURDEDRAFT_82231
   03400 DNA repair and recombination proteins [BR:adl03400]
    AURDEDRAFT_82231
Enzymes [BR:adl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AURDEDRAFT_82231
    6.5.1.6  DNA ligase (ATP or NAD+)
     AURDEDRAFT_82231
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     AURDEDRAFT_82231
DNA replication proteins [BR:adl03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    AURDEDRAFT_82231
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     AURDEDRAFT_82231
DNA repair and recombination proteins [BR:adl03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     AURDEDRAFT_82231
   NER (nucleotide excision repair)
    Other NER factors
     AURDEDRAFT_82231
   MMR (mismatch excision repair)
    Other MMR factors
     AURDEDRAFT_82231
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C PNKP_ligase Arena_ncap_C
Motif
Other DBs
NCBI-ProteinID: EJD52578
JGI: 82231
LinkDB All DBs
AA seq 795 aa AA seqDB search
MELQWAATTNGGVPPPPPLDIQSTTEHSITPPVSLASPERVPRAAGAGTLISSSAPRVEV
DWPDLSQDPLQFSSASCPWHASNSQAPYEFLAHTLATLSSTRSRILILNALTNTIRLLTV
HDPASLLPAMYLLSNGLSPVYLPLPELGIGPAVITKALQHVSGLSNTALRKLYTETGDPG
DVAFAAKSSLRTLIAHAPLTIPGVYKSLLKIATAKGQGSAKTKQSIVEKLLVAAQGEEAR
YVVRTLGQNLRVGAVRTTLLTALARAMALDRAPAVEHPTQSDYYVDPALSRQVSSARTTG
KKKKSDAQEDEARQLVNSRFAKAEALIRRVFVQHPNYDHIVEALLKYGIERLDEHVQLEV
GVPLHPALGTPTRSLDEVYDRLGDAAFTAEMKLDGQRGQIHATRGPDSRLTVRVFSRHLE
DMTDKYPDICSLVEHIFAGRPGLTSLIIDSEIVAVDKKTNALRSFQELSNRARKDVQLTD
VKVAVCVFAFDLMYLNGQVLIQEPFRRRRELLRAQLPPFVPDDEHSARFDHMANCESADG
REAVEDFWNQALELKTEGLMVKLLDHTSVVEEESIQPGTSKPARRKPLLASYEPDRRTFS
WIKLKRDYVTGLGDSLDLVPVGAWHGNGRKASWWSPILLACYDSAKGQFVGVCKCMSGFT
DAFYKGLNERYPDTENSATCSRTSLWNVETGGLRPEVFFKPREVWEIKGADITLSPVSVA
AYGLVSSERGLSLRFPRFIRLRDDKSVEHASEPETLVRMWKSQERTTKGGADEGDLVDVD
FVGDVEDENEDDDDV
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggagctgcagtgggctgcgaccactaacggcggcgtaccgcctccgcccccactcgac
atacagtccacgactgagcattccatcacgcctcctgtttcattagcatcgcccgagcgc
gttcctcgcgcagccggcgcgggtacgctcatttccagcagcgctccgcgtgttgaggtc
gactggcccgatttatcccaggatccactgcagttctcgagcgcctcctgtccgtggcat
gcttctaacagtcaggcaccgtacgaattcctggctcacaccctggctactctctcatcg
actcgctcgcgcatcctgatcctcaacgcgctcacgaacacgatccgcctgctcaccgtg
cacgacccggcgtctctgctccccgcgatgtatctgctatcgaacggtctatctcccgtt
tatctgcctcttcccgaacttggaattggcccagcggtcatcacgaaggctctccagcac
gtttccggcctctctaacaccgcgctccgtaaattgtacactgagacaggagacccaggc
gacgttgcgttcgccgcgaagtcctctctacgtacgctgatagcgcacgcgccactaact
atccctggcgtctacaagtccctgctcaaaatcgcaaccgccaaaggacaaggttctgcg
aaaacgaaacagtccattgtcgagaaactgctagtcgctgcgcaaggggaagaagcgcgg
tacgtagtccgtaccttgggtcagaaccttcgagtgggtgctgtcaggactacgctgctg
acagcactcgctcgcgcaatggccctcgaccgtgcgccagccgtcgagcatcctacgcag
tccgactattacgtcgaccctgctctgagccgacaagtctcctcggctaggacaaccggg
aagaagaagaagtccgatgcgcaggaggacgaagcccggcagctggtcaactcgcgattt
gctaaggccgaggcattgatacgtcgggtcttcgttcagcaccccaactatgaccacatc
gtggaagcactcctcaaatatggtattgagcggctcgatgaacacgttcagctagaagtt
ggcgttcctctccatccggccctagggactccgaccagatcgctggatgaggtgtacgac
cgcctcggagatgctgcgttcacagcggagatgaagcttgatgggcaacgtggtcaaatc
cacgcgactcgcgggcccgattcccggctcaccgtcagagtcttcagtcgacacctcgag
gacatgacggacaagtaccctgacatatgctccctcgtggaacacatcttcgcaggtcgt
cccggtctaacgtctttgatcatcgactccgaaatcgttgccgtcgacaagaaaacaaac
gcactgcgctcatttcaagaattatcaaatcgtgccaggaaagacgttcagctgacggac
gtgaaggtggcagtatgcgtgtttgcgtttgatttaatgtacctgaatggacaagtgctt
attcaagaaccgttccgacgccggcgggagttgttgcgcgctcagctgccaccattcgtg
cccgatgacgagcattccgctcgcttcgaccacatggctaattgcgaaagcgctgatggt
cgcgaggccgtcgaagatttctggaatcaggcactcgagctcaagacggaagggttaatg
gtcaagcttctggaccacaccagtgtcgttgaagaagaatctattcagcctggcacgtcc
aagcctgctagaagaaagcctctcctggcgtcttacgagccagataggcgaactttctct
tggatcaagctgaagcgcgactacgttactggcctgggagatagccttgacctcgtgcct
gtaggggcatggcatgggaatgggcgcaaggctagctggtggtcgcccatcctgctcgcc
tgctacgactcggcgaaaggccagttcgtcggggtgtgcaaatgcatgagcggctttacg
gacgcattctacaaggggctgaacgaacgctatcccgacaccgaaaactcagccacttgt
agccgaacgtcgctgtggaatgttgagacgggaggtttgcgacccgaagtgttcttcaag
ccgcgtgaggtctgggaaatcaaaggcgccgacataacgctcagtccggtctccgttgcg
gcgtatgggttggtttcgtctgagcgcggcctcagtctccggtttccgcgcttcatccgc
ctgcgtgatgacaaatccgtcgagcacgcaagcgagccggagacgctcgtcagaatgtgg
aaatcccaggaacgcactacgaagggtggcgccgacgagggcgatctcgttgacgtcgac
tttgtgggcgacgtcgaagacgagaacgaggacgatgatgacgtctga

DBGET integrated database retrieval system