KEGG   Auricularia subglabra: AURDEDRAFT_84076Help
Entry
AURDEDRAFT_84076  CDS       T03129                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
adl  Auricularia subglabra
Pathway
adl00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:adl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AURDEDRAFT_84076
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:adl02000]
    AURDEDRAFT_84076
Enzymes [BR:adl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AURDEDRAFT_84076
Transporters [BR:adl02000]
 Other Transporters
  Pores ion channels [TC:1]
   AURDEDRAFT_84076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_5 GST_C_3 TetR_C_6
Motif
Other DBs
NCBI-ProteinID: EJD51073
JGI: 84076
LinkDB All DBs
AA seq 257 aa AA seqDB search
MSHPDQKIHPHATGVAAKTVEKHQDKQELVFYAGWFCPFVQRSWIALEEKGVPYQYVEVN
PYKKEPHFLAINPKGLVPSAEVNGKALYESLVLNEFFEDFFNTGPHVPNLLPLDPIEKAR
ARIWIDFIAKSLVPGFMRLVMAQEADEQRKHLDEYYANLTTLCKQVKGPYFLGDQFSLVD
ATIAPWVARDYILHENRAYERSGAGKAWEDYAKALETRPSVVNTQSDKEHYATIYARYLK
NEAMSEAAKAIRQGRSF
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacccggaccaaaagatacacccccacgcgacaggtgtcgcggcgaagactgtt
gaaaagcaccaggacaagcaggaactagtcttttatgcgggctggttctgtccgttcgtc
cagcgcagctggatcgcgctcgaggagaagggagtgccgtaccagtatgtcgaagtgaac
ccgtacaagaaggaaccgcacttcctcgccatcaacccaaagggcctcgtccctagcgct
gaagtgaacggcaaggcgctgtacgagtctctcgtcctgaacgagttcttcgaggacttc
ttcaacaccggcccgcacgtgcccaacctactgccgctggaccccatcgagaaggcgcgc
gcgcgcatctggatcgacttcatcgcgaagtcgctcgtgccgggattcatgcgcctcgtc
atggcgcaggaggcggacgagcagcgcaagcacctcgacgagtactacgcgaacctcacg
acgctgtgcaagcaggtcaagggcccgtacttcctcggagaccagttctcgctcgtcgat
gcgaccatcgcgccctgggttgcgcgcgactacatcttgcatgagaatcgtgcctacgag
cgcagcggcgcgggcaaagcgtgggaggactatgccaaagccctcgagacgcgcccgagt
gtcgtcaacacccaaagcgataaggaacactacgcgaccatctacgcccgctacctgaag
aacgaggccatgagcgaggccgcgaaggccatacgccagggaaggagcttctaa

DBGET integrated database retrieval system