KEGG   Alicycliphilus denitrificans BC: Alide_0290Help
Entry
Alide_0290        CDS       T01397                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00473  D-Alanine metabolism
adn01100  Metabolic pathways
adn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:adn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Alide_0290
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Alide_0290
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:adn01011]
    Alide_0290
Enzymes [BR:adn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Alide_0290
Peptidoglycan biosynthesis and degradation proteins [BR:adn01011]
 Precursor biosynthesis
  Racemase
   Alide_0290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADU98071
UniProt: E8TTW8
LinkDB All DBs
Position
323210..324304
Genome map
AA seq 364 aa AA seqDB search
MPRPILATIHPAAVQHNLERARRAAPDARMWAVVKANAYGHGIERVFEGLRSADGIALLD
MAEAERVRRLGWRGPVLLLEGVFEPRDLELCSRLSLWHAVHCDEQIDWLAAHKTQAPHRV
FLKMNSGMNRLGFAPGRYRSAWARLNALPQVDEISFMTHFSDADGPRGIAHQVQAFHRAT
QDLPGERCIANSAAILRHGGEAQVRLDWVRAGIALYGSAPDHPERTAVDWGLEPAMTLAS
RIIGVQQLQAGDTVGYGSRFTAEGPLAIGVVACGYADGYPRHCDTGTPVLVNGVRTRTIG
RVSMDMIAVDLTPVPGAGMGAEVTLWGRAANGVVLPIDEVAEAGGTVGYELMCALAPRVP
VSVD
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgccccatccttgccaccatccaccccgcagccgtgcagcacaacctcgagcgt
gcgcgccgcgccgcgcccgatgcgcgcatgtgggccgtggtcaaagccaacgcctacggc
cacggcatagagcgcgtgttcgagggcctgcgctcggccgacggcatcgcgctgctggac
atggcagaggccgagcgcgtgcgccggctcggctggcgcggccccgtcctgctgctggag
ggcgtgttcgagccgcgcgacctggagctgtgctcgcgcctgtcgctgtggcacgccgtg
cactgcgacgagcagatcgactggctggccgcgcacaagacccaggcgccgcaccgcgtg
ttcctcaagatgaactccggcatgaaccgcctgggcttcgcgcccgggcgctaccgctcg
gcctgggcgcgcctgaacgcgctgccgcaggtggacgagatctccttcatgacgcatttc
tccgatgccgacgggccgcgcggcatcgcccaccaggtgcaggccttccatcgcgccacg
caggacctgccgggcgagcgctgcatcgccaacagcgccgccatcctgcgccatggtggc
gaggcccaggtgcgcctggactgggtgcgcgccggcatcgcgctgtacggcagcgcgccc
gaccatcccgagcgcaccgccgtcgactggggcctggagccggccatgacgctggcctcg
cgcatcatcggcgtgcagcagctgcaggcgggcgacaccgtgggctatggctcgcgcttc
acggccgaggggccgctcgccatcggcgtcgtggcctgcggctacgccgacggctacccg
cgccactgcgacaccggcacgcccgtgctggtcaatggcgtgcgcacgcgcaccatcggc
cgcgtgagcatggacatgatcgccgtggacctcacgcccgtgcccggcgccggcatgggc
gccgaggtcactctctggggccgcgccgccaacggcgtcgtgctgcccatcgacgaggtg
gccgaggccggtggcaccgtgggctacgagctcatgtgtgcgctcgcgccgcgcgttccc
gtttccgtagactga

DBGET integrated database retrieval system