KEGG   Alicycliphilus denitrificans BC: Alide_0405Help
Entry
Alide_0405        CDS       T01397                                 

Definition
(GenBank) Beta-lactamase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00550  Peptidoglycan biosynthesis
adn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Alide_0405
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:adn01002]
    Alide_0405
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:adn01011]
    Alide_0405
Enzymes [BR:adn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Alide_0405
Peptidases and inhibitors [BR:adn01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   Alide_0405
Peptidoglycan biosynthesis and degradation proteins [BR:adn01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Alide_0405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: ADU98181
UniProt: E8TVH1
LinkDB All DBs
Position
431980..433143
Genome map
AA seq 387 aa AA seqDB search
MKSLLSSLRSLACAALMAPAILWAQAPQPPEIAARNYLLVDVTAGQVLAAKDIDAPVEQA
SLTKLMTGYLVFDALRAKKITLEQRLPVSERAWKMPGSRMFIDPKMQVPVDDLLKGMIVQ
SGNDATMALAEGVGGTAENFVRLMNEQAKALGMKNTAYKNPEGLTEPGHTTTARDLATLA
TRLIQDFPEYMHYYSTKQYRYEGTPASNSNNRNTLLFRDPTVDGLKTGHTAAAGYCLVAT
SKRDFPNVGQRRLLSIVLGAASENSRANESQKLLNWGYTAFDAVKLFDAGQAADTPAVWK
GTQSTLKIGRPDAIVVTVPSGSAGKLSTEIVRKDPLIAPFTKGQPIGALKVRLGGEQVAE
VPLVALEDVGQAGIFGRAWDAIRLWIK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctctcctgtcctcgttgcgatcccttgcctgtgccgcgctgatggcgcccgcc
atcctctgggcccaggcgccccagccccccgaaatcgccgcgcgcaactacctgctggtg
gacgtgacggcaggccaggtgctggccgccaaggacatcgacgcgccggtggagcaggcg
tcgctgaccaagctcatgaccggctacctcgtgttcgacgcgctgcgcgccaagaagatc
acgctggagcagcgcctgcccgtgagcgagcgtgcctggaagatgccgggctcgcgcatg
ttcatcgaccccaagatgcaggtgccggtcgatgacctgctcaagggcatgatcgtgcag
tcgggcaacgatgccaccatggccctggccgagggcgtgggcggcacggcggagaacttc
gtgcgcctgatgaacgagcaggccaaggcgctgggcatgaagaacaccgcctacaagaac
cccgagggcctgaccgagcccggccacactaccacggcgcgcgacctggccacgctcgcc
acgcggctgatacaggacttccccgagtacatgcattactactccaccaagcaatatcgc
tacgagggcacgccggcctccaatagcaacaaccgcaacacgctgctgttccgcgacccg
acggtcgatggtctgaagaccggccacacggccgccgcgggctactgcctggtggccacg
tccaagcgcgacttcccgaacgtggggcagcgccgcctgctgtccatcgtgctcggcgcc
gccagcgagaattcccgcgccaacgaaagccagaagctgctgaactggggctacacggcg
ttcgacgccgtcaagctgttcgacgccggccaggccgccgacacgccggccgtctggaag
ggcacgcagagcacgctcaagatcggccgccccgacgccatcgtggtcactgtgccctcg
ggcagcgccggcaagctgagtaccgagatcgtgcgcaaggacccgctgatcgcgcccttc
accaagggccagcccatcggcgcgctgaaggtgaggctcggcggcgaacaggtggccgag
gtgcctctggtggctctggaggacgtggggcaggccggtatcttcggccgcgcctgggac
gccatccgcctgtggatcaagtag

DBGET integrated database retrieval system