KEGG   Alicycliphilus denitrificans BC: Alide_1958Help
Entry
Alide_1958        CDS       T01397                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00020  Citrate cycle (TCA cycle)
adn00190  Oxidative phosphorylation
adn00650  Butanoate metabolism
adn01100  Metabolic pathways
adn01110  Biosynthesis of secondary metabolites
adn01120  Microbial metabolism in diverse environments
adn01130  Biosynthesis of antibiotics
adn01200  Carbon metabolism
Module
adn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
adn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
adn_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:adn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Alide_1958
   00650 Butanoate metabolism
    Alide_1958
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Alide_1958
Enzymes [BR:adn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Alide_1958
    1.3.5.4  fumarate reductase (quinol)
     Alide_1958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_7 Fer4_18 Fer4 Fer4_4 Fer2
Motif
Other DBs
NCBI-ProteinID: ADU99701
UniProt: E8TYB5
LinkDB All DBs
Position
complement(2025595..2026299)
Genome map
AA seq 234 aa AA seqDB search
MQRTFKIYRYDPDKDAKPYMQTLQVELDGHERMLLDALLKLKKQDPSLSFRRSCREGVCG
SDAMNINGKNGLACLTNMKTLQGDIVLKPLPGLPVIRDLIVDMTQFFNQYHSIKPYLQND
EPTSPSKERLQSPEEREELDGLYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIAD
SRDKATGERLDNLEDPYRLFRCHTIMNCVDVCPKGLKPAAAISKIKELMVRRAI
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcactttcaagatctatcgctacgacccggacaaggacgccaagccctacatg
cagacgctgcaggtggagctcgacggccatgagcgcatgctgctggacgcgctgctcaag
ctcaagaagcaggacccttcgctgtcgttccgccgctcctgccgcgagggcgtgtgcggt
tcggacgcaatgaacatcaacggcaagaacggcctggcgtgcctcaccaacatgaagacg
ctgcagggcgacatcgtcctcaagcccctgcccggcctgcccgtgatccgcgacctgatc
gtggacatgacgcagttctttaaccagtaccactcgatcaagccctatctgcagaacgac
gagccgacgtcgccctccaaggagcgcctgcagtcgcctgaggagcgcgaggaactcgac
ggcctgtacgagtgcattctgtgcgcgagctgctccacctcctgccccagcttctggtgg
aatccggacaagttcgtcggcccggcaggcctcctgcaagcctaccgcttcatcgccgac
agccgcgacaaggccaccggcgagcgcctggacaacctggaggacccctaccggctgttc
cgctgccacaccatcatgaactgtgtggatgtatgccctaagggtctcaagcctgcggcc
gcgatcagcaagatcaaggaactgatggtgcgccgcgccatctga

DBGET integrated database retrieval system