KEGG   Alicycliphilus denitrificans BC: Alide_1959Help
Entry
Alide_1959        CDS       T01397                                 

Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00020  Citrate cycle (TCA cycle)
adn00190  Oxidative phosphorylation
adn00650  Butanoate metabolism
adn01100  Metabolic pathways
adn01110  Biosynthesis of secondary metabolites
adn01120  Microbial metabolism in diverse environments
adn01130  Biosynthesis of antibiotics
adn01200  Carbon metabolism
Module
adn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
adn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
adn_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:adn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Alide_1959
   00650 Butanoate metabolism
    Alide_1959
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Alide_1959
Enzymes [BR:adn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Alide_1959
    1.3.5.4  fumarate reductase (quinol)
     Alide_1959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 FAD_binding_3 DAO GIDA HI0933_like Pyr_redox_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ADU99702
UniProt: E8TYB6
LinkDB All DBs
Position
complement(2026328..2028133)
Genome map
AA seq 601 aa AA seqDB search
MSYTKKDIAVRKFDVVIVGAGGSGMRASLELSRAGLSVACLSKVFPTRSHTVAAQGGVSA
SLGNMSEDNWHYHFYDTIKGGDWLSDQDAVEFMCREAPNVVIELEHFGMPFDRNPDGTIY
QRPFGGHTANYGEKPVQRACAAADRTGHAMLHTLYQKNVESKTNFFVEWMALDLIRNSAG
DVVGVTALELETGDLYELHAKAVLLATGGAGRIFAASTNAFINTGDGLGMAARAGIPLQD
LEFWQFHPTGVAGAGVLLTEGCRGEGAILLNSNGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGCGPNKDYILMKLDHLGADTIRKRLPSVEEIGHNFANVDITKEPIPVVPTIHYQ
MGGIPTNVHGQVVVWDGEKNNVVNGLYAVGECAAVSVHGANRLGTNSLLDLLVFGKSAGK
HIVEFVKGFGDHHAVPADASDRTLARLNQLEDSKDGVYAQDLANDIRQTMQSHAGVFRTQ
KGMDEGVEKIAAIRERVSSIGLKDKSKVWNTARMEALEVDNLIEVAQATMVSAAARKECR
GAHTVDDYEHPADHPTAPLGRDDVNWLKHTLWHSQTNSLTYKPVNMKPLTVDSIPPKVRT
F
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgagttacaccaaaaaagacattgccgttcgcaaattcgatgtcgtcatcgtcggcgcc
ggcggctccggcatgcgcgcctcgctcgaactctcgcgcgccggcctctccgtggcctgc
ctgtccaaggtcttccccacccgctcgcacaccgtagccgcccagggcggcgtatccgca
tcgctcggcaatatgagcgaggacaactggcactaccacttctacgacaccatcaagggc
ggtgactggctgtccgaccaggacgcggtggaattcatgtgccgcgaggcacccaacgtg
gtgatcgagctggaacacttcggcatgccgttcgaccgcaaccccgacggcaccatctac
cagcgccccttcggcggccacaccgccaactacggcgagaagcccgtgcagcgcgcctgc
gccgccgccgaccgcaccggccacgccatgctgcacacgctgtaccagaagaacgtcgag
tccaagaccaacttcttcgtggaatggatggcactggacctgatccgcaacagcgccggc
gacgtggtcggcgtgaccgcgctggaactggaaaccggcgacctgtacgagctgcacgcc
aaggccgtgctgctggccacgggcggcgcgggccgcatcttcgccgcatcgaccaacgcc
ttcatcaacaccggcgacggcctcggcatggccgcacgcgcaggcattccgctgcaggac
ctggagttctggcagttccatcccaccggcgtggccggcgcgggcgtactgctgaccgag
ggctgccgcggcgaaggcgccatcctgctcaacagcaacggcgagcgcttcatggagcgc
tacgcccccaccttgaaggacctggccccgcgcgacttcgtctcgcgctccatggaccag
gagatcaaggaaggccgcggctgcggcccgaacaaggactacatcctgatgaagctcgac
cacctgggcgcggacaccatcaggaagcgcctgccctcggtggaggagatcggccacaac
ttcgccaacgtggacatcaccaaggagccgatccccgtggtgcccaccattcactaccag
atgggcggcatcccgaccaacgtccacggccaggtcgtggtgtgggacggcgagaagaac
aacgtcgtcaatggcctgtacgccgtgggcgaatgtgccgcagtgtcggtgcatggcgcc
aaccgcctgggcaccaactcgctgctggacctgctggtgttcggcaaatccgcaggcaag
cacatcgtcgaattcgtgaagggctttggcgaccaccatgccgttccggccgatgccagc
gaccgcacgctggcgcgcctgaaccagttggaagactccaaggacggtgtctacgcacag
gatctggccaacgatatccgccagaccatgcagtcccacgccggcgtgttccgcacgcaa
aagggcatggacgaaggcgtggagaagatcgccgccatccgcgagcgcgtctcctcgatc
gggctcaaggacaagtccaaggtctggaacaccgcccgcatggaagcgctggaggtagac
aacctgatcgaggtggcgcaggccaccatggtctcggccgctgcgcgcaaggaatgccgc
ggcgcccacacggtggacgattacgaacaccccgccgaccaccccaccgcgccgctgggc
cgcgacgacgtcaactggctcaagcacacgctgtggcacagccagaccaacagcctgacc
tacaagccggtgaacatgaagccgctgacagtggacagcatccctccgaaggttcgcacg
ttctaa

DBGET integrated database retrieval system