KEGG   Alicycliphilus denitrificans BC: Alide_2947Help
Entry
Alide_2947        CDS       T01397                                 

Definition
(GenBank) Aldehyde Dehydrogenase
Organism
adn  Alicycliphilus denitrificans BC
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADV00674
UniProt: E8TW10
LinkDB All DBs
Position
3053653..3055125
Genome map
AA seq 490 aa AA seqDB search
MTSQALNVPHADRFYIGGQWVEPSSDATFTVLNSATEEIVARVPQATEADADAAVQAARQ
AFDHGPWPRMTPAERAVYMDRIAERLEALNDDFARIWTTESGVLYKIAQPRVGQYLSGAF
RQYSAMAHTYPFIKPVKSTSGHQGYQIQEPVGVSVAIVPWNGPAGLIAYKVAPALLAGCT
VIIKSSPEAPCSGNLFAQICDEVGLPPGVVNAITADREVSESLVRNPGVDKITFTGSTAA
GRRIGAVASERVARCTLELGGKSPALVLDDYDVEAAAKLLGTAYFSYLTGQVCASLTRII
VPRAKHDAMVDALVDAARGMVIGDPFDPATTMGPLASERQRGTVERMVAQGVAEGARLAV
GGGRPKHLERGFFFEPTVFANVDNSSFIARNEFFGPVLSVIAADSEQHAIDMANDSIYGL
NAAVFTHDAEHAMRVARQLRSGSVGHNASRYDFAIGFGGFKQSGIGREGGEGGLEAFLES
KTVVLDQMAP
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaccagccaagccttgaacgtaccccatgccgaccgcttctacatcggcggccagtgg
gtcgagccctccagcgacgcgaccttcaccgtgctcaacagcgccaccgaagaaatcgtg
gcacgcgtgccccaggccaccgaggccgacgccgacgccgccgtgcaggccgcgcgccag
gccttcgaccacggcccctggccgcgcatgaccccggccgagcgcgccgtctacatggac
aggatcgccgagcgcctggaagcgctgaacgacgatttcgcgcgcatatggaccaccgaa
tccggcgtgctgtacaagatcgcccagccgcgcgtaggccagtacctgagcggcgcgttc
cgccagtactccgccatggcgcacacctacccgttcatcaagcccgtcaagtccaccagc
ggccaccagggctaccagatccaggagcccgtgggcgtgtccgtcgccatcgtgccgtgg
aacggcccggcgggcctgatcgcctacaaggtggcacccgcgctgctggcgggctgcacg
gtcatcatcaagtcctcgcccgaggcaccctgctccggcaacctcttcgcgcagatctgc
gacgaggtgggcctgccgcccggcgtggtcaacgcgatcaccgccgaccgcgaggtctcc
gaatcgctggtgcgcaatcccggcgtggacaagatcaccttcaccggctccaccgccgcg
ggccggcgcatcggcgccgtggcctccgagcgcgtggcccgctgcacgctggagctgggc
ggcaagtcgcccgccctggtgctggacgactacgacgtcgaggcggccgccaagctgctg
ggcacggcctacttcagctacctgacgggacaggtgtgcgccagcctgacccgcatcatc
gtgccccgcgccaagcacgacgcgatggtggacgcgctggtggacgccgcgcgcggcatg
gtgatcggcgacccgttcgaccccgccaccaccatggggcccctagcatccgagcgccag
cgcggcaccgtggagcgcatggtggcccagggcgtcgccgagggcgccaggctggcggtc
ggcggcggcaggcccaagcacctggaacgcggcttcttcttcgagcccaccgtgttcgcc
aacgtggacaacagctccttcatcgcgcgcaacgagttcttcggccccgtgctctcggtg
atcgccgccgacagcgagcagcacgccatcgacatggccaacgacagcatctacggcctg
aacgccgccgtgttcacccacgacgccgagcacgccatgcgggtggcgcggcagctgcgc
tccggcagcgtggggcacaacgcctcgcgctacgacttcgcgatcggcttcggcggcttc
aagcagtcgggcataggccgcgagggcggcgagggcgggctcgaagccttcctcgaatcc
aagaccgtggtgctcgaccagatggcgccctga

DBGET integrated database retrieval system