KEGG   Alicycliphilus denitrificans BC: Alide_3704Help
Entry
Alide_3704        CDS       T01397                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00473  D-Alanine metabolism
adn00550  Peptidoglycan biosynthesis
adn01100  Metabolic pathways
adn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:adn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Alide_3704
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Alide_3704
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Alide_3704
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:adn01011]
    Alide_3704
Enzymes [BR:adn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Alide_3704
Peptidoglycan biosynthesis and degradation proteins [BR:adn01011]
 Precursor biosynthesis
  Amino acid ligase
   Alide_3704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp ATPgrasp_ST CPSase_L_D2 TTL ATP-grasp_4 GARS_A RimK ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ADV01420
UniProt: E8TR69
LinkDB All DBs
Position
complement(3855156..3856124)
Genome map
AA seq 322 aa AA seqDB search
MTQNDLKIDVQALGKVAVLMGGDSAEREVSLMSGGGVLQALRARGVDAHAFDPAHADLSE
LKTHGYQRCFIALHGRHGEDGTVQGALELLGIPYTGPGVMASSIAMDKIMTKRIWRFEGL
PTPDWRLVSSSAETAQAFQELGSPMIVKPSREGSTIGLTKVTSLGQCEQAYRLAAQHDPE
VLCEQFIDGDETTCPVLGQGDAAQALPVIRIVAPEGNYDYQNKYFTDVTQYHCPSGLPEA
EEREIRRIVVQAYRTLGCRGWARADIMVRKSDRKPFLLEINTSPGMTGHSLVPMSAKASG
ISYPDLCLRILASASLDALQGK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaatgacctgaaaatcgacgtgcaggcgctgggcaaggtggccgtgctcatg
ggcggcgattcggccgagcgcgaggtctcgctcatgtccggcggcggcgtgctgcaggcg
ctgcgcgcgcgcggcgtcgatgcccatgcgttcgatcccgcgcacgccgacctgtcggaa
ctcaagacccacggctaccagcgctgcttcatcgccctgcatggccgccacggcgaggac
ggcacggtgcagggcgcgctggagctgctgggcatcccctataccggccccggcgtcatg
gcgtccagcatcgccatggacaagatcatgaccaagcgcatctggcgcttcgagggcctg
cccacgcccgactggcggctcgtctccagcagcgccgagacggcccaggccttccaagag
ctgggctcgcccatgatcgtcaagccctcgcgcgagggctccaccatcggcctgaccaag
gtcacctcgctgggccagtgcgagcaggcctaccgcctcgccgcgcagcacgaccccgag
gtgctgtgcgagcagttcatcgacggcgacgagaccacctgccccgtgctgggccagggc
gatgcggcgcaggccctgcccgtgatccgcatcgtggcgcccgagggcaactacgactac
cagaacaagtacttcaccgacgtcacgcagtaccactgcccgagcggcctgccggaggcc
gaggagcgggagatccggcgcatcgtggttcaggcctaccgcaccctgggctgccgcggc
tgggcgcgcgccgacatcatggtccgtaagagcgaccgcaagccctttctgctggagatc
aacacctctcccggcatgaccggccactcgctcgtgcccatgtcggccaaggccagcggc
atcagctaccccgacctgtgcctgcgcatcctggccagcgcgtcgctggacgcattgcag
gggaagtga

DBGET integrated database retrieval system