KEGG   Alicycliphilus denitrificans BC: Alide_3979Help
Entry
Alide_3979        CDS       T01397                                 

Definition
(GenBank) 4-hydroxybenzoate polyprenyl transferase
  KO
K03179  4-hydroxybenzoate polyprenyltransferase [EC:2.5.1.39]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00130  Ubiquinone and other terpenoid-quinone biosynthesis
adn01100  Metabolic pathways
adn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:adn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Alide_3979
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:adn01006]
    Alide_3979
Enzymes [BR:adn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.39  4-hydroxybenzoate polyprenyltransferase
     Alide_3979
Prenyltransferases [BR:adn01006]
 Compound prenylation
  4HB prenyltransferase
   Alide_3979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UbiA Mx_ML
Motif
Other DBs
NCBI-ProteinID: ADV01685
UniProt: E8TUH3
LinkDB All DBs
Position
complement(4153322..4154194)
Genome map
AA seq 290 aa AA seqDB search
MTAVAARSRLSLYLDLIRFNRPAGWLVLVWPTLVALWVAADGFPGWHLLLVFAAGTPLMR
SAGCCINDIADRDFDRHVKRTTQRPITSGRISVAEAALVGAALALVSLALVLSTRWEAVA
WSVPAVAFTILYPFTKRFFAMPQAFLGLAFNFGIVIAFAAVQGRVPATGWVLWLANMFLV
LAYDTEYAMVDRDDDLKIGMKTSAITLGRFDVAAIMAFFAACLALTAWVLAPYGLGWPLW
LGLAVAAAQVLWHYRLIRGRTREGCFAAFSSSHWIGASIFAGVVLGFALR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgttgccgcgcgctcgcgcctgtccctgtacctcgacctgatccgcttcaac
cgccccgcgggctggcttgtgctggtgtggcccacgctggtggcgctgtgggtggcggcc
gacggctttcccggctggcatctgctgctggtcttcgcggccggcacgccgctcatgagg
agcgccggctgctgcatcaacgacattgccgaccgcgacttcgaccgccatgtgaagcgc
accacgcagcggcccatcaccagcggccggatcagcgtggcggaggcggccctggtgggc
gcggcgctggcgctggtgtcccttgcgctggtgctcagcacgcgctgggaggccgtggcc
tggtcggtgccggccgtggcgttcaccatcctctacccgttcaccaagcgtttcttcgcc
atgccgcaggccttcttggggctagcgttcaacttcggcatcgtcatcgccttcgccgcc
gtgcagggccgcgtgccggccacgggctgggtgctgtggctggcgaacatgttcctggtg
ctggcctacgacaccgagtacgccatggtggaccgcgacgacgacctgaagatcggcatg
aagacctcggccatcacgctggggcgcttcgacgtggcggccatcatggcattcttcgcc
gcctgcctggccttgacggcctgggtgcttgcgccctacggcctgggctggccgctgtgg
ctggggctggccgtggcggcggcgcaggtgctgtggcactaccggctgatccgcgggcgt
acgcgcgaggggtgcttcgccgcgttcagcagcagccactggatcggcgcgtcgatcttc
gccggcgtggtgcttgggtttgcgctgcgctga

DBGET integrated database retrieval system