KEGG   Alicycliphilus denitrificans BC: Alide_3996Help
Entry
Alide_3996        CDS       T01397                                 

Definition
(GenBank) cobyrinic acid a,c-diamide synthase
  KO
K12055  chromosome partitioning related protein ParA
Organism
adn  Alicycliphilus denitrificans BC
Brite
KEGG Orthology (KO) [BR:adn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:adn02044]
    Alide_3996
Secretion system [BR:adn02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Alide_3996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_31 CbiA ParA CBP_BcsQ VirC1 MipZ ArsA_ATPase SRP54 Bclx_interact Fer4_NifH CLP1_P
Motif
Other DBs
NCBI-ProteinID: ADV01702
UniProt: E8TUJ0
LinkDB All DBs
Position
4170988..4171863
Genome map
AA seq 291 aa AA seqDB search
MQVVSIISTKGGVGKTTTAANLGGLAADAGLRVLLLDLDVQPTLSSYYELTQRAPGGIYE
LLAFNERDLGQLVSRTIIAGLDLVLSNDHRGELNTLLLHAPDGRLRLRHLLPALAPLYDL
VLIDTQGARSVLLEMAVLASDLALSPVTPEILAARELRRGTMQLLEDIAPYRHLGIEPPP
LHLLINRVHPVSANARLIQQALRDLFQDHAGIRVLATDVPAIEAYPRAATRGLPVHRVEH
RQPPGRVAPASLDTMRALASELFPQWQDRFAAMSGRPPRPLDAGRSHGERT
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcgtatccatcatttcaacgaagggcggcgtcggcaagaccacgacggccgcc
aacctgggcgggctcgccgcggacgcgggcctgcgcgtgctgctgctcgatctcgacgtg
cagcccaccttgtcctcctactacgaactgacccagcgcgcgccgggcggcatctatgag
ctgttggccttcaacgagcgcgaccttggccagctcgtgtcccgcacgatcatcgcgggc
ctggacctggtgctgtccaacgaccaccggggcgagctgaacaccttattgctgcatgcg
ccggatggccgcctgcggctgcggcatctgctgccagcacttgctcccctctacgacctg
gtgctgatcgacacccagggcgcgcgttccgtgctgctggagatggcggtgctcgcctcc
gaccttgcgctgtcgcccgtcacgccggaaatcctcgcggcccgggagcttcgacgcggc
accatgcagttgctcgaagacatcgcgccgtaccggcacctgggcatcgaaccgccgccg
ctgcacctgctcatcaaccgcgtccacccggtgtcggcgaacgcccgactgatccagcag
gccctgcgcgacctgttccaagaccatgccggcatccgcgtgctcgccaccgacgtgcca
gccatcgaagcctatccgcgcgccgcgacgcgcggcctgccggtgcatcgggtcgagcac
cgccagccgcccggcagggtcgcgccggcctcgctcgacacgatgcgcgcgctcgcgagc
gagctgttcccgcaatggcaggacagatttgccgcaatgtccggtcgcccgccacgtcct
cttgatgccgggaggtcccatggcgaacgcacatga

DBGET integrated database retrieval system