KEGG   Alicycliphilus denitrificans BC: Alide_4007Help
Entry
Alide_4007        CDS       T01397                                 

Definition
(GenBank) hypothetical protein
Organism
adn  Alicycliphilus denitrificans BC
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TilS
Motif
Other DBs
NCBI-ProteinID: ADV01713
UniProt: E8TUK1
LinkDB All DBs
Position
4181744..4182091
Genome map
AA seq 115 aa AA seqDB search
MWLFDRRCVKPDKANASALALLPRDSAHRLDRLWMLVRDTCPLPLLDHWRETVLELLQTR
EMLARLPFALGPLEGHRLAIDVPALTLALGSLIRSDVLTAYPYPAKIWTPEAVAA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
gtgtggctgttcgaccggcgctgcgtcaagcccgacaaggccaacgccagcgcgctggca
ttgctgccacgcgatagcgcccaccggcttgaccgcctgtggatgctggtgcgggacacc
tgcccgttgccgctgctcgaccactggcgcgagaccgtgctggaactgctgcaaacccgc
gagatgctggcccgccttccgttcgccctcgggccactggaaggccatcggctcgccatc
gacgtgccggcgctgaccctggcgctgggttccctgatccgcagtgacgtgctcaccgcc
tatccctatccggccaagatctggacgccggaagcggtagcggcttga

DBGET integrated database retrieval system