KEGG   Alicycliphilus denitrificans BC: Alide_4016Help
Entry
Alide_4016        CDS       T01397                                 

Definition
(GenBank) hypothetical protein
Organism
adn  Alicycliphilus denitrificans BC
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2859
Motif
Other DBs
NCBI-ProteinID: ADV01722
UniProt: E8TUL0
LinkDB All DBs
Position
4189141..4189689
Genome map
AA seq 182 aa AA seqDB search
MTKPHPAHLAFTVLLVLLAGLPLASRAGEPLIVVEDHGGTSALPYYEALNLQPRANAPAR
PPIPTPRVPATPADEAAMLPVRSTKLTPGTVARRVIEAPGLRPFAVIGDDEASRAWLQRR
GAALRERGAVGLVVNVETVQGLARLRTLAPGVPLAPVAGDDLADRLGLRHYPALITATGI
EQ
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaccccatccggcccatctcgcattcacggtcctgctcgtgctgctggcaggc
ctgccgctggcctcgcgtgccggcgagccgctgatcgtggtcgaggaccatggcggcacg
tcggcgctgccgtactacgaggccctgaacctccagccgcgcgccaacgcgccggcccgg
ccacccatcccgacgccccgggttcccgccacgccagcggacgaagccgcgatgctgccg
gtgcgcagcaccaagctcacgcccggcaccgtcgcgcggcgcgtgatcgaagcgcccggc
ctgcggccgttcgcggtcatcggcgacgacgaggcttcccgggcctggttgcagcggcgc
ggcgcggctttgcgcgaacgcggcgcggtcggcctggtggtcaacgtcgagaccgtgcag
ggcctggcacggctgcgtaccctggcgccgggcgtgcccctcgcgcccgtggccggagac
gacctggccgatcgcctgggcctgcggcactacccggcgctgatcacggccaccggcatc
gagcaatga

DBGET integrated database retrieval system