KEGG   Alicycliphilus denitrificans BC: Alide_4047Help
Entry
Alide_4047        CDS       T01397                                 

Definition
(GenBank) hypothetical protein
Organism
adn  Alicycliphilus denitrificans BC
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_CBD
Motif
Other DBs
NCBI-ProteinID: ADV01751
UniProt: E8TVA6
LinkDB All DBs
Position
complement(4218240..4219187)
Genome map
AA seq 315 aa AA seqDB search
MDTLTLGPGAALVARDFSPRDADDVPVARNVAEHAVAYLFEPVALLPGLKLGDIFRLFEA
CPELHAVFRRNWSFAVCEEARKGPVPRPRHDHPAEDAGIEYLELYWSWALDTGSKVYRGV
HRLDLHGVGPVLEADCPTYDVKAGDRIRWALSLTPVRELLDLPLRLCEELTIVEDDLDSK
GWRETVATGRCAEVLLGQVIQGVLDELCFHGGPQEKEEASDGLKAQLAEMEAGTMRTTPA
DDLFEELDRPGFVALFETLGGIRPAEVSRAIRAIEDDEPVGPALERAFDGEVVVKMQFRS
RPGREFRKLFRAAGR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggacaccctgacccttggtcctggcgcggccctcgttgcccgcgatttctccccccgc
gacgccgacgatgtccctgtcgcgcgcaacgtcgccgagcacgcggtggcttaccttttt
gagccagtggcgctgcttcccgggctgaagctgggcgacatcttccggttgttcgaggct
tgccccgagctccatgccgtctttcgcagaaactggtcgttcgcggtctgtgaagaagca
cgcaaaggccccgtgccccgaccacgccacgaccatcccgccgaagatgcgggcatcgaa
tatctggagctgtactggtcttgggcgctggacacaggttccaaggtgtacagaggggtg
catagactcgatttgcacggcgtggggcctgtcctggaggcggactgccccacgtatgac
gtcaaggccggggaccgcatccgctgggcactgtcgctgacgccagtgcgtgaattgctg
gatcttcccctgcgcctgtgtgaagaactgaccatcgttgaggatgatttggattccaag
ggctggcgggaaactgtcgcaacagggcgctgtgccgaggtgctgttggggcaagtgatc
cagggcgtgctggacgaactctgctttcacggcggtccccaggagaaggaggaggcgagt
gacggactcaaagcgcaactggcagagatggaggccggaaccatgagaactacgccagcc
gacgacttgtttgaagaactcgaccggcccggcttcgttgcactcttcgagacgctcggt
ggcatccgcccggcagaggtcagccgtgccatccgagcgattgaggatgacgagcctgtc
ggcccggctctggagcgtgcgttcgatggcgaggtggtggtcaagatgcaattccggagc
cgtcctggacgcgagttccgcaagctgttccgggcggcaggccgctaa

DBGET integrated database retrieval system