KEGG   Alicycliphilus denitrificans BC: Alide_4074Help
Entry
Alide_4074        CDS       T01397                                 

Definition
(GenBank) response regulator receiver
  KO
K22010  two-component system, response regulator PdtaR
Organism
adn  Alicycliphilus denitrificans BC
Brite
KEGG Orthology (KO) [BR:adn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:adn02022]
    Alide_4074
Two-component system [BR:adn02022]
 Other families
  PdtaS-PdtaR
   Alide_4074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg ANTAR
Motif
Other DBs
NCBI-ProteinID: ADV01778
UniProt: E8TVD3
LinkDB All DBs
Position
complement(4252097..4252702)
Genome map
AA seq 201 aa AA seqDB search
MTGSGDAHGSASLLLVDDDRLILGTLAAGLRHMGYRVAVADSVEQAEALLGGGLHPDLAI
VDVRLPGRDGLSLAQRLAEVDHVPFLMLSAYSDSGIVERATHSGALGYLVKPLALNQIQP
AIETALQRAGELEGLRRMSAQLQAALDADREINVATGITMVQYRMARRPAFELLRNAARA
QRRKLSAVAQEIVRACELLHR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgacgggctccggcgacgcgcatggttcagccagcctgctgctggtggacgacgaccgg
ctgatactgggcacgctggccgcgggcctgcgccacatgggctaccgggtggcggtcgcc
gacagcgtggagcaggcggaggcgctgctcggcggcggcctgcaccccgatctcgcgatc
gtggacgtgcgcctgccggggcgcgacggcctgtcgctggcgcagcggctggccgaggtc
gaccacgtgccgttcctgatgctcagcgcctacagcgactccggcatcgtagagcgtgcc
acacacagcggtgccctgggctatctggtcaagccgctggccctgaaccagatccagccg
gcgatcgaaaccgcgctgcagcgcgccggggagctggagggcctgcgccgcatgagcgcc
cagctgcaggccgcgctcgacgccgaccgcgagatcaacgtggccaccggcatcaccatg
gtgcagtaccgcatggcgcgccggccggccttcgagctgctgcgcaatgccgcgcgcgcc
cagcggcgcaagctgagcgcggtggcgcaggagatcgtccgggcctgcgagctgctgcac
cgttga

DBGET integrated database retrieval system