KEGG   Altererythrobacter dongtanensis: A6F68_00923Help
Entry
A6F68_00923       CDS       T04466                                 

Definition
(GenBank) Putative fatty-acid--CoA ligase fadD21
  KO
K00666  fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
ado  Altererythrobacter dongtanensis
Brite
KEGG Orthology (KO) [BR:ado00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ado01004]
    A6F68_00923
Enzymes [BR:ado01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     A6F68_00923
Lipid biosynthesis proteins [BR:ado01004]
 Acyl-CoA synthetase
  Unknown
   A6F68_00923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C_2 HA1
Motif
Other DBs
NCBI-ProteinID: ANY19449
UniProt: A0A1B2ABB1
LinkDB All DBs
Position
complement(967672..969411)
Genome map
AA seq 579 aa AA seqDB search
MTDSKPMPTPNDCPLPRRRSDFATFAEAIDYAARSAKGLNFHDMRGDLERPYPFAEMRAD
ALKMAYRLIAAGIGREDRVALVAETSPEFAALFCGCVYAGAWPVPLPLPTTFGGKESYID
QLSVQLESSDPKMLIYPGEIAEMAKAAADRQGCEGISWEEFAQADAPQADLPELSPDDIC
YLQYSSGSTRFPTGVAVTHRALLHNLYGHATGVDLGVNDRVVSWLPWYHDMGLVGCFLSP
IANQASCDYLKTEHFARRPLAWLDLISRNPGNTLSYSPTFGYDICARRISSQSQVSERFD
LSRWRTAGNGADMIRPDVMQNFVNAFAEAGFKASAFTPSYGLAEATLAVTVMPPGEGIRV
ELVEEERLSGAERDLSRPARYRAIVNCGKPLPGMEVEIRGEHGEIKGDHQIGKVWCRGES
VMHSYFRNEEATNDCLVHGWLDTGDMGYLGDGYLFIVGRAKDMIIINGKNHWPQDIEWAV
EQLPGFNHGDVAAFSFETEGGEEAPAVLVHCRVSDPEERVRLHEAIRDKVRSITGMNCVV
ELVPPRTLPRTSSGKLSRAKAKRLYLAGEIEPIRLLEAA
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattcgaaaccgatgccgacgccgaacgactgtccgcttccgcggcgccgttcc
gacttcgccacgttcgccgaagccatcgactacgccgcgcgtagcgcgaaggggctcaat
ttccacgacatgcggggcgacctcgagcgcccctacccgttcgccgagatgcgggccgac
gcgctgaagatggcctatcgcctgatcgccgccggcatcggccgcgaagaccgcgtggcg
ctcgtcgccgagacgagccccgagttcgccgcgctgttctgcggctgcgtctatgccggc
gcctggcccgtgccgctgccgctgccgaccactttcggcggcaaggaaagctacatcgac
cagctttcggtccagctcgagagttcggaccccaagatgctgatctatcccggcgagatc
gcggagatggccaaggcggccgccgaccgacaggggtgcgaggggatcagctgggaagaa
ttcgcccaggccgacgcaccgcaagccgacttgcccgaattgagcccggacgacatctgc
tacctccagtattcgagcggttcgacgcgctttcccaccggggtggcggtcacccaccgc
gcgctgctgcacaacctctacggtcacgcgaccggggtcgacctcggcgtcaacgaccgc
gtggtgagttggctgccgtggtaccacgacatgggcctagttggctgcttcctctcgccg
atcgccaaccaggcgagctgcgattatctcaagaccgagcatttcgcgcgccggccgctc
gcatggctcgacctcatcagccgcaatcccggcaacacgctcagctattcgccgaccttc
gggtacgacatctgcgcgcggcgcatctcctcgcagagccaggtgtcggagcgcttcgac
ctctcgcgctggcggaccgcgggcaacggcgccgacatgatccggcccgacgtgatgcag
aatttcgtcaacgcgtttgccgaagcgggcttcaaggcgagcgccttcaccccgagctac
ggcctcgccgaagcgaccctcgcggtcaccgtcatgccgccgggcgaaggtatccgggtc
gagcttgtcgaggaggaacgcctgtccggcgccgaacgcgacctcagccgccccgcccgg
taccgcgcgatcgtcaattgcggcaagccgctgcccggcatggaagtcgagatccgcggc
gagcacggcgagatcaagggcgatcaccagatcggcaaggtctggtgccgcggcgaatcg
gtgatgcacagctatttccgcaacgaggaagcgaccaacgactgcctggtgcatggttgg
ctcgacacgggcgacatgggctacctcggcgacggttacctgttcatcgtcggccgggcg
aaggacatgatcatcatcaacggcaagaaccactggccgcaggacatcgagtgggcggtg
gagcagcttcccggcttcaaccacggcgacgtcgccgcgttcagcttcgagaccgagggc
ggcgaggaagcccctgcggtcctggtgcactgccgcgtatccgatccggaggagcgggtt
cgcctgcacgaggcgatccgcgacaaggtccgctcgatcaccggcatgaactgcgtggtc
gagctggtgcccccgcgcaccctgccgcgcacctcgtcgggcaagctcagccgcgcgaag
gccaagcggctataccttgcgggtgagatcgagccgatcaggctgctcgaagccgcctga

DBGET integrated database retrieval system