KEGG   Altererythrobacter dongtanensis: A6F68_01506Help
Entry
A6F68_01506       CDS       T04466                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ado  Altererythrobacter dongtanensis
Pathway
ado00473  D-Alanine metabolism
ado00550  Peptidoglycan biosynthesis
ado01100  Metabolic pathways
ado01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ado00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A6F68_01506 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A6F68_01506 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    A6F68_01506 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ado01011]
    A6F68_01506 (ddlB)
Enzymes [BR:ado01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A6F68_01506 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:ado01011]
 Precursor biosynthesis
  Amino acid ligase
   A6F68_01506 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 B12-binding
Motif
Other DBs
NCBI-ProteinID: ANY20022
UniProt: A0A1B2ACY4
LinkDB All DBs
Position
1537615..1538595
Genome map
AA seq 326 aa AA seqDB search
MGNPAGGAAVNARHHVAVLMGGWANERPVSLMSGEGVAKALEARGHRVTRIDMDRQVAAR
IAEAAPDVVFNALHGVPGEDGTVQGMLDLMGVPYTHSGLATSVIAIDKELTKHALVPHGI
PMPGGRIVESESIYEKDPLARPYVLKPVNEGSSVGVAIVTDESNYGNPIRKDVKGPWQEF
ERLLAEPYIRGRELTAAVLDDGTGPRALTVTELVPKSGFYDFDAKYTDGMTDHICPAQVP
ERIFKLCKAYAVQAHVLLGCNGCSRTDFRWDDEQGEDGLFVLETNTQPGMTALSLVPEQA
RHCGISYEDLVEALVEEALARAKKHG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatccagcgggtggggcggccgtgaacgccaggcaccacgtcgccgtcctgatg
ggcgggtgggccaacgagcgccccgtcagcctgatgtcgggcgagggcgtcgccaaggca
ctcgaggcgcgcgggcatcgtgtcacgcggatcgacatggaccgacaggtcgcggcgcgc
attgccgaggcggcacccgacgtcgtgttcaacgcgctccacggcgtgccgggcgaggac
gggacggtgcagggcatgctcgacctgatgggcgtgccctatacgcactcgggcctcgca
acatcggtcatcgcaatcgacaaggaactgaccaagcacgcgctcgtgccgcacggtatc
cccatgcccggcggacggatcgtcgagagcgagagcatctacgagaaggaccctcttgcg
cgtccatacgtcctgaagccggtcaacgagggcagctcggtgggcgtcgcgatcgtcacc
gacgagagcaattacggcaacccgatccgcaaggacgtgaagggcccgtggcaggagttc
gagcggctgctcgcggagccctacattcgcgggcgggagctgaccgcggcggtgctcgac
gacggcaccgggccgcgcgcgttgacagtgaccgagctcgttcccaagtcgggtttctac
gacttcgacgcgaagtacaccgacgggatgaccgaccacatctgccccgcgcaggtgccg
gagcgcatcttcaagctgtgcaaggcctacgcggtgcaggcgcacgtgctgctcggctgc
aacggctgcagccgcaccgacttccgctgggacgacgaacagggcgaggacgggctgttc
gtgctcgaaaccaacacccagccgggaatgaccgcgctcagcctcgtgcccgagcaggca
aggcactgcggcatcagctacgaggacctggtcgaggcgctggtcgaggaggcgcttgca
agagcgaagaagcatggctga

DBGET integrated database retrieval system