KEGG   Altererythrobacter dongtanensis: A6F68_02066Help
Entry
A6F68_02066       CDS       T04466                                 

Gene name
yhdG
Definition
(GenBank) putative amino acid permease YhdG
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
ado  Altererythrobacter dongtanensis
Brite
KEGG Orthology (KO) [BR:ado00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    A6F68_02066 (yhdG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C
Motif
Other DBs
NCBI-ProteinID: ANY20570
UniProt: A0A1B2AEH4
LinkDB All DBs
Position
2087846..2089459
Genome map
AA seq 537 aa AA seqDB search
MASLERENGSMFLDRVKPLDAILATAEKKSLHRTLGAFQLMLFGIGCIIGTGIFVLTAAG
AQKAGPGLMLAFIIAGLVCIVAALCYSEIASMIPVAGSAYTYSYATMGEFLAWTVGWALI
LEYAIAASAVSVGWSGYFTGTILGDTFGISLPAWLTAGPLALGGAPGGFINLPALVIALL
VTWLLMIGTSESAKVNAVLVLIKVTALTAFIALTLTSSEFDAARFNPFLPAGVFGGWGTG
VGAVGAAATIFFAYVGFDAVSTAAEETKNPQRNVPIGLVGSLLFCTVFYILVAAGAIGTI
GGQPIMGPNGVPFPAGSEELARQCAMPIYADALVCSNEALAHVLRQIGFGAIGNMLGYAA
ILALPSVILVLLFAQTRIFFVMSRDGLLPEGLSKVHPKWKTPYVVTAITGVVVAIAAAFF
PVGQLADIANAGTLYAFFMVAIAVMVLRRTDPARTRTFRVPGLMVIGPLTILGCLFLFLN
LPSAAMLVLPVWTAIGLLVYFAYSRGNSHLGKGIVEVVDDIGGQEHDFPIDTPDSHR
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctctagagagggaaaacgggtccatgttcctagaccgcgtcaagccgctcgac
gccatcctggcgacggcggaaaagaagtcgctgcaccgaacgctcggtgcatttcagctc
atgcttttcggcatcggatgcatcatcggcacgggcatcttcgtgctgactgccgccgga
gcgcaaaaggccgggcctggcctgatgctcgccttcattatcgcgggcctcgtctgcatc
gtcgccgcgctctgctactcggaaatcgcgtcgatgatcccagtcgcgggatccgcttac
acctacagctacgcgacgatgggcgaattcctggcctggacggtcggttgggcgctcatt
ctcgagtatgcgatcgccgcctcggcggtgtcggtcggatggtcggggtattttaccggc
acgatcctgggtgacacattcgggatatcgttaccggcctggctgacggcaggaccgctc
gcgctgggaggcgctcccggcggtttcatcaaccttccggcactggtcatcgcgctgctc
gtgacctggctgctcatgatcggcacaagcgaaagcgccaaggtcaatgcggtgctcgtg
ctgatcaaggtgacggcgctcaccgcgttcattgccctgacgctgacgagttccgagttc
gacgcggcgcgcttcaatccgttccttcccgccggcgtgttcgggggctggggcacgggc
gtgggcgcggtcggcgcggctgccacgatcttcttcgcctatgtcggattcgatgcggtt
tccacggctgccgaagaaaccaagaaccctcagcgcaacgtgcccatcggtctcgtcggc
tcgctcctgttctgcaccgtgttctacatcctcgtcgcggcgggcgcgatcggcaccatc
ggcggtcagccgatcatgggtccgaatggtgtgccgttccctgcgggttccgaagaactt
gcgcgtcagtgcgcgatgccgatctatgccgatgccctggtctgctcgaacgaggcgcta
gcgcacgttctgcgtcaaatcggcttcggcgcgatcggcaacatgctcggctatgcggcg
atcctcgcccttccgtcggtgatcttggtgctgctgttcgcgcagacgcgcatcttcttc
gtgatgagccgcgacgggttgctgcccgagggcctgtcgaaggtgcaccccaagtggaag
acgccgtatgtcgtgaccgcgatcaccggcgtggtcgtggcgattgccgcagcgtttttc
cccgtcggtcagctcgctgatatcgcgaatgcgggtacgctgtacgccttcttcatggtg
gcgatcgcggtgatggtgctgcggcgaaccgaccctgcgcggacccgcacgttccgggtc
ccggggcttatggtgatcggtccgctcacgattctgggctgtctgttcctgttcctcaac
ctgccgtctgcggcaatgctggtgctgccggtttggacggcgatcgggctgctggtctat
ttcgcctacagccgcggcaatagccatctgggcaagggcatcgtggaggtagtcgatgac
atcggtggccaggaacacgatttcccgatcgatacgccggatagccaccgctag

DBGET integrated database retrieval system