KEGG   Altererythrobacter dongtanensis: A6F68_02213Help
Entry
A6F68_02213       CDS       T04466                                 

Definition
(GenBank) ComEC family competence protein
  KO
K02238  competence protein ComEC
Organism
ado  Altererythrobacter dongtanensis
Brite
KEGG Orthology (KO) [BR:ado00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ado02044]
    A6F68_02213
Secretion system [BR:ado02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components
   A6F68_02213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Competence DUF4131
Motif
Other DBs
NCBI-ProteinID: ANY20713
UniProt: A0A1B2AEY7
LinkDB All DBs
Position
complement(2224938..2227130)
Genome map
AA seq 730 aa AA seqDB search
MATGTVPLVPLSDDGDKGDPTVDAALQRPWRKARPLSSAADLADRFLERAAFDRAPWLAV
ALAAGIAAWFALPTPVTWLAWLAGWTLAAIAAAALWAGKETRSYLRRASIAVAMLAAFGL
ALVWARSELVGAEPLARPQVSWIDGRVLAREDRPAEGRVRLTLAYRDAEGGMARKIRVNV
SPELIGDGVEEGARIRLRARLMPPGPPMVPGAYDFARTAWFAGLAATGSAMGPVETIEPA
PPGGTIARAQRALSAHVHSRLDGSAGAIAAAFASGDRGGIAIADEEAMRDSGLTHLLSIS
GVHVSAVIAAAYVLAVRLLALWPWLVLRVRLPLVGAAVAAGAGIAYTLLTGAEVPTVRSC
VGALLVLIALALGREPLSMRMVATAAFAVLLVWPEALVGPSFQMSFSAVIAIVALHEAAP
VRAFLAPREERWIARAGRRAAMLLLTGLVIEIALMPIVLFHFHRAGFYGALANVVAIPLV
TFISMPLIALALFLDLLGLGAPIWWLAGQSLELLLAIARFTADQPGAVRLMPQMGWGTFA
LFIAGGLWLALWRGKARLLGLVASGAGAIALLFTPTPDVLVSDDGRHVGIVGEGDRLLVL
REGRSDFARDNLLELAGLEGDPVPLERWPDARCSADFCSLDVVREGRTWTLLMARSRSRI
EERSLAAACEKSDIVVADRFLPMSCRPRWLKADRRFLSENGGLAVVLRSETIETVAAGQG
QHPWWTARGR
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccggtacagtgccgttggtgcccctgtccgacgatggggataagggcgaccct
acggtcgatgctgcactgcagcggccttggcgcaaggcgcgccccttgtccagtgcggca
gacctggcagaccggtttctggaacgtgcggcatttgaccgggcaccctggctcgctgtc
gccctggccgcaggtattgcggcatggttcgccctcccgacgcctgtaacctggctcgcc
tggctcgcaggatggacgctcgcggctatcgcggcggccgctctgtgggccggcaaggag
acgcgatcgtacttgcgccgcgcgtccatcgcagtggcgatgctggcggccttcggcctg
gcgctcgtctgggcgcgctccgaactggtcggggcggagccgctggcgcgcccacaggtc
agctggatcgacggccgcgtcctcgcgcgcgaggaccggcctgccgagggccgggttcgc
ctgacgctggcttatcgcgatgccgagggcggaatggcgcggaagatccgcgtgaatgtt
tcgcccgaactgatcggcgacggtgttgaggagggcgcccgtatcaggctccgcgcgcga
ctgatgccgcccggtccgccgatggtgcccggcgcctacgatttcgcccgcacggcgtgg
ttcgcgggccttgccgccaccgggagcgcgatgggcccggtcgaaacgatagagcccgct
ccgcctggtggcaccatagcaagggcgcagcgggcactgtcagcccatgtccactcgcgg
ctcgacggatcggccggtgccatagcggctgccttcgcgagcggcgaccgcggcgggatc
gccatcgccgatgaggaggcgatgagggactccggcctcacccatctcctgtctatcagc
ggagttcatgtcagcgcggtgattgccgccgcctacgtcctggcggtgcgcctgctcgcg
ctttggccatggctcgtgctgcgggtccgcctgccgctcgtcggcgccgcggtcgccgcc
ggcgctggcatcgcctataccctgctgaccggcgcggaagtgcccacggtgcgcagctgc
gtcggtgcactgctggtcctcatcgcgctggcgctggggcgagagccgctgtccatgcgg
atggtggcgactgcggctttcgccgtccttctcgtgtggcccgaagcgctcgtcgggccg
agcttccagatgagcttttcggcggtcatcgcgatcgtcgccttgcacgaggcggcgccg
gtccgtgcatttctcgccccgcgcgaggagcgatggattgcccgcgccggaagacgtgcc
gcgatgctgttgctgacggggctcgtcatcgaaatcgcactcatgccgatcgtcctgttc
catttccaccgggcaggcttctacggcgcgctcgccaatgtggtcgccattccgctggtg
actttcatttccatgccgctgatcgcgctggccttattcctcgacctgctcggcctgggg
gcgccgatttggtggttggcaggccaatcgctcgagctgttgctcgccatcgcgcggttc
accgcggaccaacccggggcggtgcgcctgatgccgcaaatgggttggggcaccttcgcc
ctgttcatcgctggggggttatggcttgcgctctggcgcgggaaggcccgcctgcttggc
ctggtggcctctggagcgggagcgatagcgcttctttttacgccaacgcccgacgttctc
gtgagtgacgatgggcgtcacgtgggaattgtcggcgagggtgaccgcctgctggtcttg
cgtgaaggacgcagcgatttcgctcgagacaacctgctcgaacttgccgggttggaaggt
gatccggtgccgctcgaacgctggcccgatgcccgatgcagtgcggatttctgttcactg
gatgtcgtacgcgaagggcgcacctggacgctgctcatggctcgcagccggtcgcgcatc
gaagagcggtcgctcgctgcggcgtgcgagaagtcggatatcgtggtcgcggatcgcttc
ctgccgatgagttgccgtccgcgctggttgaaggccgatcggcgcttcctgtcggagaat
ggcggcctcgcggtggttttgcggagcgaaacgatcgaaacggttgccgccgggcagggt
cagcatccgtggtggactgccagggggcgataa

DBGET integrated database retrieval system