KEGG   Altererythrobacter dongtanensis: A6F68_02269Help
Entry
A6F68_02269       CDS       T04466                                 

Gene name
sdhB
Definition
(GenBank) Succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ado  Altererythrobacter dongtanensis
Pathway
ado00020  Citrate cycle (TCA cycle)
ado00190  Oxidative phosphorylation
ado00650  Butanoate metabolism
ado01100  Metabolic pathways
ado01110  Biosynthesis of secondary metabolites
ado01120  Microbial metabolism in diverse environments
ado01130  Biosynthesis of antibiotics
ado01200  Carbon metabolism
Module
ado_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ado_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ado_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ado00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A6F68_02269 (sdhB)
   00650 Butanoate metabolism
    A6F68_02269 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A6F68_02269 (sdhB)
Enzymes [BR:ado01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A6F68_02269 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     A6F68_02269 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer2 Fer4_9
Motif
Other DBs
NCBI-ProteinID: ANY20769
UniProt: A0A1B2AF38
LinkDB All DBs
Position
2282424..2283284
Genome map
AA seq 286 aa AA seqDB search
MQRLPLPSPVEALDGEASFRSRTLAIMATFTLPKNSKITGKGRSHPASGATRKKSFKIYR
FDPDSGENPRYDTFEIDLDECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCSMNIDG
KNGLACTTAIEDLKGEVRITPLPAMQVIKDLVPDFTHFYAQYASIRPWLQTVSPTPSGKE
RLQSPEQREKLDGLYECILCACCSTACPSYWWNSDKFLGPAILLQAYRWLADSRDEMTGE
RLDALEDPFRLYRCHTIMNCSNVCPKGLSPARAIAEIKKMQAERHI
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcctgcccttgccctcgccggtcgaagcgttagatggggaggcaagcttccgc
tcgaggaccctcgcgatcatggccacctttaccctgccgaaaaactcgaagatcaccggc
aagggccgctcgcacccggcctcgggcgcgacgcgcaagaagagcttcaagatctaccgc
ttcgatccggacagcggcgagaacccccgttacgacacgtttgagatcgacctcgacgag
tgcgggccgatggtcctcgacgcgctcatcaagatcaagaacgagatcgacccgaccctc
accttccgccgctcgtgccgcgaggggatctgcggctcttgctcgatgaatatcgatggc
aagaacggccttgcctgcaccaccgcgatcgaggacctcaagggcgaagtgcgcataacg
ccgcttcccgcgatgcaggtcatcaaggacctcgtgcccgacttcacccatttctatgcc
cagtacgccagcatccgcccgtggcttcagaccgtgagcccgacgcccagcggcaaggaa
cgccttcagtcgcccgagcagcgcgagaagctcgacgggctctacgagtgcatcctgtgc
gcgtgctgctcgaccgcctgccccagctactggtggaacagcgacaagttcctggggccg
gcgatcctgctgcaggcgtatcgctggctggccgacagccgcgacgagatgactggcgag
cggctcgacgcgctggaagacccgttccgtctctaccgctgccacacgatcatgaactgc
tcgaacgtgtgtccgaaggggctcagccccgcacgcgcgatcgccgagatcaagaagatg
caggccgaacggcatatctga

DBGET integrated database retrieval system