KEGG   Actinobacillus delphinicola: NCTC12871_00394
Entry
NCTC12871_00394   CDS       T06572                                 

Gene name
rlmL
Definition
(GenBank) 23S rRNA m(2)G2445 methyltransferase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
adp  Actinobacillus delphinicola
Brite
KEGG Orthology (KO) [BR:adp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:adp03009]
    NCTC12871_00394 (rlmL)
Enzymes [BR:adp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     NCTC12871_00394 (rlmL)
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     NCTC12871_00394 (rlmL)
Ribosome biogenesis [BR:adp03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    NCTC12871_00394 (rlmL)
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 Methyltransf_25 Methyltransf_31 Methyltransf_15 MTS Methyltransf_11 N6_Mtase
Other DBs
NCBI-ProteinID: VEJ08970
UniProt: A0A448TSH6
LinkDB
Position
1:complement(414301..416454)
AA seq 717 aa
MKQLFATTARGFEELLKVELTQLGAQQCRIAQGGVHYEADQETLYRTLLWSRLASRILLP
LTQAKIFSDMDLYSSVYNQNWKDIFDPRCTFFVDFNGTNEVIRHSQFGAMRIKDAIVDYF
ERHGFPRPTVDKQNPDIRIHAYLNRDELILSLDLSGEALHLRGYRTAAGEAPLRETLAAA
IILRSGWDKVTPLVDPMCGSGTLLIEGAQMAANIAPNLKRQHWGFDFWKDHDETIWTKVK
AEAEQQAKDGQNIPAQFYGSDLDSKVLEKAKRNAEQADVGHLIHWQQSDIADFKNPCESE
VTGTVVCNPPYGERLGTTPALIALYSVFGQKLKTEFAGWNASIFSSEPSLLDCLRLRSHR
QFKAKNGPLECLQKNYKISENAKDRADQQLTFEKNAQVAPDFANRLQKNRKKIEKWAKKE
GIEAYRLYDADLPEYNLAVDVYGDHVVIQEYAAPKNVDENKARQRLLDAISATLSVLDVE
TNKLILKVRQKQKGTNQYEKLAHKGEYFYVKEYNANLWVNLTDYLDTGLFLDHRKTRKML
GEMAAGKDFLNLFAYTGAGTVHAAIGGAKSTTTVDMSHTYLNWAEQNLELNDIHTGRKHR
LIQADCLQWLDECKSDFDLIFVDPPTFSNSKRMEDSWDVQRDHPKLFTNLAKILRPNGTI
IFSNNKRGFKMDFDALEKLGLKAIEISKRTLPLDFERNPKIHNCWQIIWQPMPVDNK
NT seq 2154 nt   +upstreamnt  +downstreamnt
atgaaacaactttttgctaccactgcacgtggatttgaagaacttttaaaagtggaattg
acccaactgggtgcccaacaatgccgtatcgcacaaggcggggtacattatgaggcggat
caagaaacactctatcgaaccttattatggtcacgtttagcgtcacgtattttactacct
cttacacaagctaaaattttcagtgatatggatttgtattcctcagtttataatcaaaac
tggaaagatatttttgatcctcgttgtactttttttgttgattttaatggaacaaacgaa
gttattcgccatagtcagtttggtgcaatgcgtatcaaagatgcgattgtagattacttt
gaacgtcatggttttcctcgtccaactgtggataaacaaaatcctgatatccgtattcat
gcttatttaaatcgtgatgaattaatcctttctcttgatttaagtggtgaggctttacat
ttaagaggttaccgtacggcagcaggtgaagcaccactacgtgaaaccttagcagccgca
attattttgcgctcaggttgggataaagtaacgccattagttgatccaatgtgtggttca
ggaacacttctgattgaaggtgcgcaaatggctgcaaatattgcaccaaatttaaaacgc
caacattggggatttgatttctggaaagatcatgatgaaactatttggacaaaagtaaaa
gccgaagctgagcaacaagcaaaagatggtcaaaatattcctgcacaattctatggctca
gacttggattcgaaagttttagaaaaagcaaaacgtaatgccgaacaagccgacgtaggg
catcttatccattggcaacaaagtgacatcgcagattttaaaaatccttgtgaaagtgaa
gttacgggaaccgtcgtgtgtaacccgccatacggtgagcgactaggcacaaccccagca
ctaattgcactttattctgtctttggacaaaaattaaaaacagaatttgctggttggaat
gcatcgatttttagtagcgaaccaagtttattagattgcttacgtttacgttctcatcgc
caatttaaagcgaagaatggaccgttagaatgcttacaaaagaattataaaatcagtgaa
aatgcgaaagatcgagctgatcagcagttaacttttgagaaaaatgcacaagtggcgcct
gattttgctaaccgtttacaaaaaaatcgtaaaaaaattgaaaaatgggcgaaaaaagag
gggattgaggcatatcgtttatatgatgcggatttgcctgaatataatctcgctgtcgat
gtttacggggatcatgttgttatccaagaatatgctgcacctaagaatgtggatgaaaac
aaagctcgtcaacgcttattagatgcaattagtgcgacattgtctgttttagatgttgaa
acaaataagcttattttaaaagtcagacagaaacaaaaaggaaccaatcaatacgaaaaa
ttagcgcataaaggcgaatatttttatgtgaaggaatataacgcaaatttatgggtaaat
ttaactgattacttggatacaggcttattcctcgatcaccgtaaaacacgcaaaatgcta
ggcgagatggctgcaggaaaagatttcttaaatctttttgcttacacgggagcaggaacc
gttcacgcagcaataggtggggcaaaatccacaacgaccgttgatatgtcgcatacctat
ctaaactgggcagaacaaaacttagagctgaatgatattcatacaggacgtaaacaccga
cttattcaagctgattgtttgcaatggttagatgaatgtaaatctgattttgatcttatt
ttcgttgatccaccaacattttcgaattcaaaacgtatggaagatagttgggatgttcaa
cgagatcatccaaaattattcacaaatctagcgaagatcttacgaccgaatgggacgatt
attttctcaaataataaacgtggatttaagatggattttgatgctttagaaaaattaggt
ttaaaggccattgaaatttctaaaagaacattgccattagattttgaacgtaatcctaaa
attcataattgctggcaaattatttggcaaccaatgccagtagataacaaatag

DBGET integrated database retrieval system