KEGG   Achromobacter denitrificans: APT56_02715Help
Entry
APT56_02715       CDS       T04244                                 

Definition
(GenBank) L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
adt  Achromobacter denitrificans
Brite
KEGG Orthology (KO) [BR:adt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    APT56_02715
Enzymes [BR:adt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     APT56_02715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25 Pyr_redox_2 TrkA_N 2-Hacid_dh_C Shikimate_DH ThiF Sacchrp_dh_NADP DUF43
Motif
Other DBs
NCBI-ProteinID: ALX82168
LinkDB All DBs
Position
617786..618823
Genome map
AA seq 345 aa AA seqDB search
MLNCAIHGAEDLRLVEQAPEPLGPTQVRVGVKAVGICGSDLHYYRHGRVGDFVIREPLTP
GHEASGQVLEVGSAVTAVKPGDRVALDPARTCGVCRYCRQGDSNHCEAVFFFGSASRYPH
MQGAMREQVVVQEKQCVPVPDSLSFELAAFGEPLAVALHAVRSAGTLLGKTVMVVGAGPI
GALVLMAARLAGASQVIVVDIVDQTLATCAKVGATRTINAATEPAALDELAAGKGTVDVC
FEASGNYAGLANCIRATRPRGTIVTVGTLNGSSEPCPFNQIMVKSLNVIGSFRFVDEYAW
AVDYLGRGLVDVAPLLTAAVPARQAHEAFALAADRRQAMKVMVTF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgctcaattgcgcgattcatggggccgaggacttgcggctggtggaacaggcgcccgag
ccgctgggcccgacgcaggtgcgcgtcggcgtcaaggcggtcggcatctgcggttcggac
ctgcattactaccgccacggccgggtcggcgacttcgtcatccgcgaaccgctgacgccg
ggccacgaggcctcgggccaggtgctggaggtcggttcggcggtcaccgccgtcaaaccc
ggcgaccgcgtggcgctggatccggcccgcacctgcggcgtgtgccgctattgccgccag
ggcgattccaaccactgcgaggcggtgttcttcttcggcagcgccagccgctatccgcat
atgcagggcgcgatgcgcgagcaggtggtggtgcaggaaaagcaatgcgtgccggtcccg
gacagcctgtcgttcgagctggccgccttcggcgagccgctggcggtggcgctgcacgcg
gtgcgcagcgccggcacgctgctgggcaagacggtgatggtggtgggcgccgggccgatc
ggcgcgctggtgctgatggcggcgcgcctggccggcgccagccaggtcatcgtggtcgac
atcgtcgaccagaccctggcgacctgcgccaaggtcggcgccacgcgcaccatcaacgcc
gccaccgagccggccgcgctggacgagctggcggcgggcaagggcacggtcgatgtgtgc
ttcgaggcctccggcaactatgccgggctggccaactgcatccgcgccacgcggccgcgc
ggcaccatcgtcacggtgggcacgctcaatggcagcagcgagccgtgtccgttcaaccag
atcatggtcaagagcctgaacgtcatcggcagcttccgcttcgtcgatgaatacgcctgg
gcggtcgactacctgggccgcggcctggtggacgtggcgccgctgctgacggcggcggtg
ccggcgcgccaggcgcacgaggccttcgcgctggcggcggaccggcgccaggccatgaaa
gtgatggtgacgttctga

DBGET integrated database retrieval system