KEGG   Achromobacter denitrificans: APT56_04465Help
Entry
APT56_04465       CDS       T04244                                 

Definition
(GenBank) inositol monophosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
adt  Achromobacter denitrificans
Pathway
adt00521  Streptomycin biosynthesis
adt00562  Inositol phosphate metabolism
adt01100  Metabolic pathways
adt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:adt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    APT56_04465
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    APT56_04465
Enzymes [BR:adt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     APT56_04465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-ProteinID: ALX82486
LinkDB All DBs
Position
complement(991685..992560)
Genome map
AA seq 291 aa AA seqDB search
METYDPPRSLTSPIDLCAALDAAVTAAHAGAAILQSYAHHRADLVIDRKARNDLVSQADR
EAEAAIIDELQARTPKFGIVAEETGGQAQGAATWYIDPLDGTTNFLHDIPHYAVSIALIA
HAGTAISANERLARDMPVAGVVYDPSREELFTAVYGLGAWLNGRRITCSRTRTLEDSVLA
TGFPFRDFSFASQYMPMLHDAINRARGVRRMGAAALDLAWTACGRYDGYWEMGLAPWDVA
AGTLIVREAGGACSDMHRQDSWPIGGRVVAGNPDIERALHEMIAPHLDQPG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggaaacctatgacccgccccgctcgctgacctcgcccatcgacctgtgcgcggcgctg
gatgccgcggtcacggccgcccatgccggcgcggccatcctgcaatcctacgcgcatcac
cgcgccgatctggtgatcgatcgcaaggcgcgcaacgatctggtgtcgcaggccgaccgc
gaggccgaagccgccatcatcgacgaactgcaggcgcgcacgccgaaattcggcatcgtc
gccgaggaaaccggcggtcaggcgcagggcgcggccacctggtacatcgatccgctggac
ggcaccaccaatttcctgcacgacatcccgcactatgcggtgtcgatcgcgctgatcgcc
cacgccggcaccgccatctccgccaacgagcgcctggcgcgggacatgccggtggcgggc
gtggtctacgaccccagccgcgaagaactcttcaccgcggtgtatggcctgggcgcctgg
ctcaatggccgccgcatcacttgctcgcgcacccgcacgctcgaagactcggtgctggcc
accggctttccgttccgcgacttctccttcgccagtcagtacatgccgatgctgcacgac
gccatcaaccgcgcgcgcggcgtgcggcgcatgggcgcggccgcgctcgacctggcctgg
accgcctgcggccgctatgacggctattgggaaatgggcctggcgccctgggacgtggcc
gccggcacgctgatcgtgcgcgaggcgggcggcgcctgcagcgacatgcaccggcaggat
tcctggcccatcggcggacgcgtggtggccggcaacccggacatcgaacgcgccctgcac
gagatgatcgcgccgcacctggaccagccgggctga

DBGET integrated database retrieval system