KEGG   Achromobacter denitrificans: APT56_13680Help
Entry
APT56_13680       CDS       T04244                                 

Definition
(GenBank) alpha-amylase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
adt  Achromobacter denitrificans
Pathway
adt00500  Starch and sucrose metabolism
adt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    APT56_13680
Enzymes [BR:adt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     APT56_13680
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     APT56_13680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459
Motif
Other DBs
NCBI-ProteinID: ALX84149
LinkDB All DBs
Position
complement(3047423..3050764)
Genome map
AA seq 1113 aa AA seqDB search
MNSDTPPQDDGLWYKDAVVYQLHVKSFFDSNDDGVGDLPGLISKLDYIANLGVDTIWLLP
FYPSPRRDDGYDIADYRGVHPDYGTVADVRRLIRAAHARGLRVITELVVNHTSDQHPWFQ
RARSSRPGSAARNFYVWSDNDKAYAGTRVIFCDTEKSNWTWDPVANAYFWHRFYSHQPDL
NYDNPQVLKEVLAVMRHWLDMGVDGLRLDAVPYLVEREGTNNENLPETHQVLKRIRAVID
AEYPGRLLLAEANQWPEDAQEYFGDGDECHMSFHFPLMPRMYMAIAQEDRFPITDIIRQT
PDIPATCQWAIFLRNHDELTLEMVTSRERDYLWSVYAADPRARINLGIRRRLAPLLERDR
RRVELMNSLLLSMPGTPVLYYGDELGMGDNVHLGDRDGVRTPMQWSPDRNGGFSRADPER
LPLPVLMGPLYGYEAVNVEAQQRDPHSLLNWTRRMLAQRRQTRAFGRGTLRFIQAGNRKI
LAYLRQWRDTTILCVANLSNAAQPVELPLQAFNGRVPVEMLGGTPFPAIGELPYLLTLPP
YGFYWMDLSAEAAPPGWHASLPERMPELVTLVLRGHANAVLTDASRVALETEVLPEYLAR
QRWFPGATPPARARLAYATPFGADGAEYYWAEAEPADTGAGQRVQVPFALVWDETAQVQY
PIARVRRGPEVGILADAFLQSGFVLGVVQALRAGREWDGRQGGKPGERPGVIRCQAEPGL
AALDLGAEPALQWISGEQSNSSVVIGGQAILKLLRNAEPGLSAEVEMSRHLTRAGYANIP
TLLGEVRRIDADDTPCTLAVLYAYIANEGDAWGWTLDFLKRALATALLGGDSPEEFEASL
EGYATFAATIGRRVAQLHQVLSRPSDDPAFAPARASREDADALAASVTAQLDRAAKALRH
RLDTLEEPSRACAQWLFEHHDRLTARIERMAQSLAGSPLIRVHGDLHLGQVLVAQTDAYL
IDFEGEPDHPLAQRRQLASPAKDVAGMLRSFDYAAAAVARQDPLGGAPADANAAPVENAA
TANSPAQLRDALLARFRARASEAFLQGYEETAALASPAWRTLLQLAQLEKAAYEIGYEGG
HRPDWISIPLCALAGLAHEWLRNAAIDAEDSTS
NT seq 3342 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcgacaccccgccccaggacgacggcctctggtacaaggacgcggtcgtttac
caactgcacgtgaagtcgttcttcgactccaacgacgatggcgtcggcgacctgccgggg
ctgatctccaaactggattacatcgccaacctgggggtcgacacgatctggctgctgccg
ttctatccctcgcctcgccgcgacgacggctacgacatcgccgactaccgcggcgtgcat
cccgactacggcaccgtggccgacgtgcgccggctgattcgcgccgcccatgcgcgcggg
ctgcgcgtcatcaccgaattggtggtcaaccatacctccgaccagcacccgtggttccag
cgcgcccgcagttcgcggcccggttcggccgcgcgcaatttctatgtatggtcggataac
gacaaggcctacgccggcacccgcgtcatcttctgcgacaccgaaaaatcgaactggacc
tgggatccggtcgccaatgcctacttctggcaccgcttctattcgcaccagcccgacctg
aactacgacaacccgcaggtgttaaaggaagtgctggcggtgatgcggcactggctggac
atgggcgtggacggcctgcggctggacgccgtgccgtacctggtcgagcgcgaaggcacc
aacaacgagaacctgcccgagacccaccaggtgctcaagcgcatccgcgcggtgatcgat
gccgagtacccgggacgcctgctgctggccgaggccaatcagtggcccgaggacgcgcag
gaatatttcggcgatggcgacgaatgccacatgtcgttccacttcccgctgatgccgcgc
atgtacatggcgatcgcgcaggaagaccgctttcccatcaccgacatcatccgccagacg
cccgacattcccgccacctgccagtgggccatcttcctgcgcaaccacgacgaactgacg
ctggagatggtcaccagccgcgaacgcgactacctgtggagcgtctacgccgccgatccg
cgcgcccgcatcaacctgggcatccgccggcggctggcgccgctgctggaacgcgaccgg
cgccgggtcgagctgatgaacagcctgctgctgtcgatgcccggcacgccggtgctgtac
tacggcgacgaactgggcatgggcgacaacgtgcacctgggcgaccgcgacggcgtgcgc
acgccgatgcagtggtcgcccgaccgcaacggcggcttctcgcgcgccgaccccgagcgc
ctgccgctgccggtgctgatggggccgctgtatggctacgaggccgtcaacgtcgaggcc
cagcagcgcgacccgcattcgctgctgaactggacccgccgcatgctggcgcagcgccgc
cagacccgcgccttcggccgcggcacgctgcgcttcatccaggccggcaaccgcaagatc
ctggcctacctgcggcagtggcgcgacaccaccatcctgtgcgtggccaacctgtcgaac
gccgcccagccggtcgaactgccgctgcaggccttcaatggccgcgtgccggtggaaatg
ctgggcggcacgccctttcccgccatcggcgaactgccgtatctgctgacgctgcctccg
tatggtttttactggatggacctgagcgccgaggccgcgccgcccggctggcatgccagc
ctgcccgaacgcatgccggagctggtcacgctggtattgcgcggccacgccaatgccgtc
ctcacggacgcttcgcgcgtcgcgctggaaaccgaagtgctgccggaatacctggcgcgc
cagcgctggtttccgggcgccacgccgccggcgcgggcgcggctggcctacgccacgccg
ttcggcgccgatggcgcggagtactactgggccgaggccgaaccggccgacaccggcgcg
ggccagcgggtgcaggtgcccttcgcgctggtgtgggatgaaaccgcgcaagtccagtat
ccgatcgcgcgggtgcggcgcgggccggaagtcggcatcctggccgacgccttcctgcaa
tccggcttcgtgctgggcgtggtccaggccctgcgcgccggccgcgagtgggacgggcgc
cagggcggcaagccgggcgagcggcccggcgtgatccgctgccaggccgagcccggcctg
gcagcgctggacctgggcgccgagccggcgctgcaatggatcagcggcgagcagtccaac
agctcggtggtgatcggcgggcaggccatcctgaaactgctgcgcaacgccgaaccgggg
ctgtcggccgaagtggaaatgagccgtcacctgacgcgcgccggctacgccaacatcccc
accctgctgggcgaggtcaggcggatcgacgccgacgacacgccgtgcaccctggcggtg
ctgtatgcctatatcgccaacgagggcgacgcctggggctggaccctggacttcctcaag
cgtgccctggccaccgcgctgctcggcggcgacagccccgaggaattcgaagccagcctg
gagggctacgcgaccttcgccgccaccatcggacggcgcgtggcgcaattgcaccaggtg
ctgtcgcgccccagcgacgacccggcgttcgcgccggcgcgggcctcgcgggaggatgcc
gacgccctcgccgccagcgtcaccgcgcaactggatcgcgccgccaaggccctgcgccac
cgcctcgataccctggaggaaccctcgcgcgcctgcgcccaatggctgttcgagcaccac
gaccggctgacggcgcggatcgaacgcatggcgcagtcgctggccggcagtccgctgatc
cgcgtgcatggcgacctgcacctgggccaggtgctggtggcgcagaccgacgcctacctg
atcgacttcgagggcgagccggatcacccgctggcgcagcgtcggcaactggcctcgccc
gccaaggacgtggccggcatgctgcggtccttcgactacgcggccgccgccgtcgcgcgc
caggatccgctgggcggcgcgcccgccgacgccaacgcggcgccggtggaaaacgccgcc
accgcgaattcgccggcgcagttgcgcgatgcgctgctggcgcgctttcgcgcccgcgcc
agcgaggccttcctgcaaggctacgaggaaaccgccgcgctggcttcacccgcctggcgc
accctgctgcaactggctcaactggaaaaggccgcctacgagatcggctacgagggcggc
caccgccccgactggatctccattccgctgtgcgccctggccggcctggcccatgaatgg
ctgcggaacgcggccatcgatgccgaggattcgacctcatga

DBGET integrated database retrieval system