KEGG   Achromobacter denitrificans: APT56_14610Help
Entry
APT56_14610       CDS       T04244                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
adt  Achromobacter denitrificans
Pathway
adt00330  Arginine and proline metabolism
adt01100  Metabolic pathways
adt01110  Biosynthesis of secondary metabolites
adt01130  Biosynthesis of antibiotics
adt01230  Biosynthesis of amino acids
Module
adt_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:adt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    APT56_14610
Enzymes [BR:adt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     APT56_14610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 NAD_Gly3P_dh_N PDH ApbA
Motif
Other DBs
NCBI-ProteinID: ALX84312
LinkDB All DBs
Position
complement(3264600..3265433)
Genome map
AA seq 277 aa AA seqDB search
MKNELSIAFIGGGNMASALASGLAGKVCPAGSIHVIDINQDSHAAWQARGMTTATAPDEA
LARCRVWVFAVKPQNMKDVVASTRQWLRDDTLVVSVAAGIRADTLAGWLGTPEAPWRRLV
RCMPNTPALVGAGITGLAALDGVGQADRDLAATMLASVGEVVWVADDAALDAVTALSGSG
PAYVFLFLEALIAGGQKVGLTAEQARQLALGTFAGATKLAAESSEPPSVLRERVTSKGGT
TAAALAAFNAAGFAGIVEDAMAAAARRSRELAEEFGK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgaactttcgattgcgttcatcggcggcggcaacatggcctccgcgctggct
tccggtcttgcgggcaaagtatgccccgccggcagcattcatgtcattgacattaaccag
gattcgcacgcggcctggcaggcccgcggcatgaccaccgcgaccgccccggacgaggcc
ctggcgcgctgccgcgtgtgggtgttcgcggtcaagccacagaacatgaaagacgttgtg
gcttccacgcgtcagtggttgcgcgacgacactttggtggtaagcgtggcggccggcatc
cgcgccgatacgctggccggctggctgggcacgcccgaggcgccgtggcgccgcctggtg
cgctgcatgcccaacaccccggcgctggtgggcgccggcatcaccggcctggcggcgctg
gatggcgtggggcaggccgaccgcgacctggccgccaccatgctggccagcgtcggcgag
gtggtctgggtggccgacgatgccgcgctggacgccgtgaccgcgctgtcgggcagcggt
ccggcctatgtcttcctgttcctcgaagccctgatcgccggcggccagaaggtcggcctg
acggccgagcaggcgcgccagctggcgctgggcacgttcgcgggcgccaccaagctggcg
gccgaatcgtccgagccgccgtcggtgctgcgcgagcgcgtcacttccaagggcggcacc
accgccgcggcgctggccgcgttcaatgccgccggcttcgccggcatcgtcgaggacgca
atggccgcggccgcgcggcgttcgcgcgagctggccgaggagttcggcaagtga

DBGET integrated database retrieval system