KEGG   Achromobacter denitrificans: APT56_15025Help
Entry
APT56_15025       CDS       T04244                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
adt  Achromobacter denitrificans
Pathway
adt00970  Aminoacyl-tRNA biosynthesis
adt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adt00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    APT56_15025
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:adt03029]
    APT56_15025
Enzymes [BR:adt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     APT56_15025
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     APT56_15025
Mitochondrial biogenesis [BR:adt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    APT56_15025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase GyrB_insert
Motif
Other DBs
NCBI-ProteinID: ALX84384
LinkDB All DBs
Position
complement(3362593..3363939)
Genome map
AA seq 448 aa AA seqDB search
MLSTLNDLTAALNDGRTTSVELTEAALARANDPAGEGARAFTRLYAESALAQARASDTLR
AAGIVRSAIEGLPISIKDLFDIEGETTMAGSVAREGEPAADANAEVVQRLIAAGAVIIGR
TNMTEFAYSGLGINPHYGTPLNPWDRATGRIPGGSSSGAAVSVADGMAVAAIGSDTGGSV
RIPAALCGLTGFKPSAWRVSMEGVLPLSANLDSIGPIAASVRCCAELDAILSGEGGPVPE
ALPLRGLRLAVPRTLALDGMDKHVSDTFARAVARLKEAGALVDEIAIPEFAELANINAKG
GFTAAEAWAWHRDLIARAGKRYDPRVVSRILRGKDMSAADYLDLLDAREAWVAAVDRRIA
GYDALIMPTTPIVAPAVADLQASDEAYYAANGLILRNPTLINFLDGCALSLPCHADGSAP
VGLMIAASNGADRRVLAIGLAVEELLAG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgctttcgaccctgaacgacctgaccgccgccctgaacgacggccgcaccacttccgtt
gaactgaccgaggccgccctggcgcgcgccaacgatccagccggcgagggcgcccgcgcc
ttcacccgcctgtacgccgagtcggcgctggcccaggcccgcgcctcggacacgctgcgc
gcggccggcatcgtgcgctcggccatcgagggtctgccgatcagcatcaaggatctgttc
gacatcgaaggcgagaccaccatggccggctcggtggcgcgcgagggtgaaccggcggcc
gacgccaacgccgaagtggtgcagcgcctgatcgccgccggcgcggtcatcatcggccgc
accaacatgaccgaattcgcctattcgggcctgggcatcaacccccattacggcacgccg
ctgaacccctgggatcgcgccacgggccgcattcctggcggctcctcgtcgggcgcggcg
gtgtcggtggccgacggcatggcggtggccgccatcggttcggacaccggcggctcggtg
cgcattcccgccgccctgtgcggcctgaccggcttcaagcccagcgcctggcgcgtgtcg
atggaaggcgtgctgccgctgtcggccaacctggactccatcggccccattgccgccagc
gtgcgctgctgcgccgaactggacgccatcctgtcgggcgagggcggcccggtgcccgag
gcgctgccgctgcgcggcctgcgcctggcggtgcccaggacgctggcgctggacggcatg
gacaagcacgtgtccgataccttcgcccgcgccgtggcgcgcctgaaggaagccggcgcc
ctggtcgacgagatcgccatcccggaattcgccgagctggccaacatcaatgccaagggc
gggttcacggccgccgaggcctgggcctggcaccgcgacctgatcgcgcgcgccggcaag
cgctacgacccgcgcgtggtgtcgcgcatcctgcgcggcaaggacatgagcgccgccgac
tacctggacctgctggacgcgcgcgaagcctgggtggcggcggtcgaccgccgcattgcc
ggctacgacgccctgatcatgccgaccacgcccatcgtggcgccggcggtggccgacctg
caagcctcggacgaagcctattacgccgccaatggcctgatcctgcgcaatcccaccctg
atcaatttcctggatggctgcgcgctgtcgctgccgtgccacgccgacggcagcgcgccg
gtcgggctgatgatcgccgccagcaacggcgccgatcgccgagtgctggcgattggcctg
gcggtcgaggaattgctcgccggctga

DBGET integrated database retrieval system