KEGG   Achromobacter denitrificans: APT56_15450Help
Entry
APT56_15450       CDS       T04244                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
adt  Achromobacter denitrificans
Pathway
adt00564  Glycerophospholipid metabolism
adt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:adt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    APT56_15450
Enzymes [BR:adt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     APT56_15450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 GIDA FAD_binding_3 NAD_binding_8 Thi4 Pyr_redox_3 Pyr_redox Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ALX84465
LinkDB All DBs
Position
3451583..3453181
Genome map
AA seq 532 aa AA seqDB search
MNQPLATVTPPDRNRLLAQLDNTPAWDVIVIGGGATGLGTAVDAASRGYRTLLIEAADFA
KGTSSKATKLVHGGVRYLAQGNISLVREALHERGLLNRNAPHLVWPLGFVVPAYNLLDQP
FYGIGLKMYDMLAGKLNLSPSRWLSRRDTLANAPTLAENVNGRGLKGGVLYYDGQFDDAR
LALSLMRTLFDLGGTAVNYVRATGLTTTGGKVDGVTAQDALGGASFTLRARCVINATGVW
VDSVRRMEDKNAPTMVAPSQGVHLTLPHDFLPGKRAILIPKTDDGRVLFVVPWNGHTIVG
TTDSPRNDLPLDPEAGAQDVDFILSTAARYLSRKPTRDDVTSVWAGLRPLVKATGDASTK
SLSREHTILVSQAGLVTVTGGKWTTYRRMAQDVVDTAIQHQLLTQASCRTESLALHGANG
LAPSQEHAGTPDSYYGSDLPVLKALPGAERMLVKSSGLSEAHVRFAARFELARSAEDVLA
RRNRALFLDAEAAMLAAPEVARILAEELGHDAAWQQRTLQELAGVAAHYRLK
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaccgctcgccaccgtcaccccgcccgaccgcaatcgcctgctggcgcaactg
gacaacacgcccgcctgggacgtgatcgtcatcggcggcggcgcgaccggcctgggcacc
gccgtcgacgctgccagccgcggctaccgcaccctgctgatcgaggcggccgacttcgcc
aagggcacctccagcaaggccaccaagctggtgcacggcggcgtgcgctacctggcgcag
ggcaacatcagcctggtgcgcgaagcgctgcacgaacgcggcctgctcaaccgcaacgcg
ccgcatctggtgtggccgttgggcttcgtggtgccggcctacaacctgctggaccagccc
ttctacggcatcggcctgaagatgtacgacatgctggccggcaagctgaatctatcgccc
agccgctggctgtcgcgtcgcgatacgctggccaacgcgccgacgctggccgagaacgtc
aacggccgcggcctgaagggcggcgtgctgtactacgacggccagttcgacgacgcgcgc
ctggcgctgagcctgatgcgcaccctgttcgacctgggcggcaccgcggtcaactacgtg
cgcgccaccggcctgaccaccaccggcggcaaggtcgacggcgtcacggcgcaggacgcg
ctgggcggcgccagcttcacgctgcgggcgcgctgcgtcatcaacgccaccggcgtctgg
gtcgacagcgtgcgccgcatggaagacaagaacgcgccgaccatggtggcgcccagccaa
ggcgtgcacctgacgctgccgcacgatttcctgcccggcaagcgcgccatcctgatcccc
aagaccgacgacggccgcgtgctgttcgtggtgccgtggaacggccacaccatcgtcggt
accaccgactcgccgcgcaacgacctgccgctggatccggaagccggcgcccaggacgtc
gatttcatcctgagcaccgccgcgcgctatctcagccgcaagccgacccgcgacgacgtc
accagcgtctgggcgggcctgcggccgctggtcaaggccaccggcgacgcctcgacaaaa
tcgctgtcgcgcgagcacaccatcctggtgtcgcaggcagggttggtgaccgtgaccggc
ggcaagtggaccacctaccgccgcatggcgcaggacgtggtcgacaccgcgatccagcac
cagttgctgacgcaggccagctgccgtaccgagtcgctggcgctgcatggcgccaacggt
ctggcgccgtcccaggaacacgccggcacgccggacagctactacggcagcgacctgccc
gtgctcaaggccctgcccggcgccgagcgcatgctggtcaagagcagcggcctgtccgaa
gcccacgtgcgcttcgccgcgcgcttcgagctggcgcgcagcgccgaggacgtgctggcg
cgccgcaaccgcgcgctgttcctggacgccgaggccgccatgctggcggcgcccgaagta
gcgcgcatcctggccgaggaactgggccacgacgccgcctggcagcaacgcacgctgcaa
gagctggccggcgtggcggcgcactaccgcctgaagtga

DBGET integrated database retrieval system