KEGG   Achromobacter denitrificans: APT56_22530Help
Entry
APT56_22530       CDS       T04244                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
adt  Achromobacter denitrificans
Pathway
adt00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:adt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    APT56_22530
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:adt02000]
    APT56_22530
Enzymes [BR:adt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     APT56_22530
Transporters [BR:adt02000]
 Other Transporters
  Pores ion channels [TC:1]
   APT56_22530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 GST_C_6
Motif
Other DBs
NCBI-ProteinID: ALX85743
LinkDB All DBs
Position
complement(5067450..5068064)
Genome map
AA seq 204 aa AA seqDB search
MLTLYHAPRSRSFRILWLLEELGVPYDTEMVSIRRRDGSGHIPPDYIDIHPHGKVPALVH
DGVPVFETPAIALYLTDLYPQAGLGPVVGDPQRGPYLTWLAYSTGVFEPAMTERAFKTAH
QQGSMGWGSADEVEQVVTRVLQSRAYFLGEHFSAVDIVLGGALQFMMQVKLIAENPVFSA
YAERLAARPAMHRALQRDGDIGEA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccctctatcacgcgccgcgctcgcgctcgttccgcatcctctggctgctggaa
gagctgggcgtgccctacgacaccgagatggtgtcgatccgccgccgcgacggttccggc
cacatcccgcccgattacatcgacatccacccgcatggcaaggtgccggcgctggtgcac
gatggggtgcctgtgttcgagacccccgccatcgcgctctacctgaccgacctgtatccg
caggcgggcctgggccccgtggtgggcgatccgcagcgcggcccctacctgacctggctg
gcctattccaccggcgtgttcgagccggccatgacggaacgcgccttcaagacggcgcac
cagcagggctcgatgggatggggctcggccgacgaggtcgagcaggtcgtgacccgcgtg
ctgcagtcgcgcgcgtatttcctgggcgagcatttcagcgccgtcgacatcgtgctgggc
ggcgccctgcagttcatgatgcaggtgaagctgatcgccgagaatccggtgttctcggcc
tatgccgaacggctggcggcgcgtccggcaatgcaccgcgcgctgcagcgcgacggcgac
atcggcgaggcctga

DBGET integrated database retrieval system