KEGG   Achromobacter denitrificans: APT56_24775Help
Entry
APT56_24775       CDS       T04244                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
adt  Achromobacter denitrificans
Pathway
adt00260  Glycine, serine and threonine metabolism
adt00630  Glyoxylate and dicarboxylate metabolism
adt00670  One carbon pool by folate
adt01100  Metabolic pathways
adt01110  Biosynthesis of secondary metabolites
adt01130  Biosynthesis of antibiotics
adt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:adt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    APT56_24775 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APT56_24775 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    APT56_24775 (gcvT)
Enzymes [BR:adt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     APT56_24775 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C POPLD
Motif
Other DBs
NCBI-ProteinID: ALX86132
LinkDB All DBs
Position
complement(5542389..5543489)
Genome map
AA seq 366 aa AA seqDB search
MSAPLKRTPLADEHIASGARMVDFGGWDMPLAYGSQLEEHHAVRQDAGMFDVSHMLNADI
TGPDAYAFLQRLVANDVAKLTVPGKALYTCMLNPQGGVIDDLIVYFFAADEWRVVVNAGT
ADKDMAWMQRVRQAGKFDVTITPRRDLAMIAVQGPNARAKVWAARPAWQAASEPLTPFVA
ARVGDDTLVARTGYTGEDGFEIVLPAAEAVQLWRDLAAQGVRPAGLGARDTLRLEAGMNL
YGQDMDELTQPGEAALTWTVSLKNPERRFIGRDALEQFATPAAFVGLKLQERGVMRAHMA
VRTKNGTGELTSGTMSPTLGVSIGFARLPQGVVAGDTVEVDIRGKWVPALVCKLPFVRNG
KAVEHS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcacccctcaaacgcaccccgctggccgacgaacatatcgcctctggcgcccgc
atggtcgacttcggcggctgggacatgcccctggcctacggctcgcaactggaagagcac
cacgcggtgcgccaggatgccggcatgttcgacgtctcgcacatgctcaacgccgacatc
accggccccgacgcctacgccttcctgcagcgcctggtggccaacgacgtggccaagctg
accgtgcccggcaaggcgctctacacctgcatgctgaacccgcagggcggcgtcattgac
gacctgatcgtgtatttcttcgccgccgacgaatggcgcgtggtggtcaacgccggcacc
gccgacaaggacatggcctggatgcagcgcgtcaggcaggccggcaagttcgacgtcacc
atcacgccgcgccgcgacctggccatgattgccgtgcagggccccaacgcccgcgccaag
gtctgggccgcgcgcccggcctggcaggccgccagcgagccgctgaccccgttcgtggcc
gcccgcgtcggcgacgacacgctggtggcgcgcaccggctacaccggcgaagacggcttc
gagatcgtgctgcccgccgccgaggcggtgcaactgtggcgcgacctggcggcccagggc
gtgcgcccggccggcctgggcgcgcgcgacacgctgcgcctggaagccggcatgaacctc
tacggccaggacatggacgaactgacccagcccggcgaagccgcgctgacctggacggtg
tccctgaagaaccccgagcgccgcttcatcggccgcgacgcgctggagcagttcgccacg
cccgccgccttcgtcggcctgaagctgcaggaacgcggcgtgatgcgcgcccacatggcg
gtgcgcaccaagaacggcacgggcgaactcaccagcggcaccatgtcgccgacgctgggc
gtgtcgatcggctttgcccgcctgccgcaaggcgtggtcgcgggcgacacggtcgaggtc
gatatccgcggcaagtgggtgcccgccctggtctgcaagctgccgtttgtccgtaacggc
aaagccgtcgaacactcgtaa

DBGET integrated database retrieval system