KEGG   Achromobacter denitrificans: APT56_25930Help
Entry
APT56_25930       CDS       T04244                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
adt  Achromobacter denitrificans
Pathway
adt00620  Pyruvate metabolism
adt00680  Methane metabolism
adt01100  Metabolic pathways
adt01120  Microbial metabolism in diverse environments
adt01200  Carbon metabolism
Module
adt_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:adt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    APT56_25930
  09102 Energy metabolism
   00680 Methane metabolism
    APT56_25930
Enzymes [BR:adt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     APT56_25930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ALX86337
LinkDB All DBs
Position
5810158..5813004
Genome map
AA seq 948 aa AA seqDB search
MNASRPQSDSAEPLRHDIRLLGRLLGEVIAECEGKRVFDTIETLRRTAVKFRREGNAADG
KLLEQRVKHLQGSDPNSVARAFSYFLHLSNIAEDRDQNRSQRARALAGDAPARGSLRDAV
QTLGRHGVTPARIRRLLADACVMPVLTAHPTEVQRKSTLDVHREIAAALVQRDNPLTPEE
LAELDAALLGRVATLWQTRMLRYTRLTVADEIENALSYYRSTFLQVIPRVYGDLSKLLNR
DAKPFGAPPPPLEPFLRMGSWIGGDRDGNPNVDAGTLERALLRQATVLFEHYLQEVHALG
AELSITTLLIAVDPALLALAEHSGDDSPHRSDEPYRRALVGVYARLAATALRLTGQDLAR
RSTVAAQPYGTPQELSADLAVIAASLSAHHGAPIGKLRLAGLQQAVEVFGFHLATVDLRQ
SSDVHERALAELFSRAGATRDGQPLDYLALDEDARVALLRAELAQARPLASPWIAYSEDT
TRELAVLRAAAAGRQRYGKQAVRQTIVSHTETLSDLLEVMVLQKEAGLIAPAGQDIPPED
GLMVVPLFETIPDLQRGADIMAAWLDLPEIRERVKRAQNGAQEVMLGYSDSNKDGGFLTS
NWSLYQAERALVDVFSSRHVRLRLFHGRGGSVGRGGGSSFDAILAQPPGTVAGQIRLTEQ
GEVIQSKYKDAEVGRWHLELLVAATLESSLAPRAEATSAEDAHMAQHGPAMSFMSETAQR
SYRGLVYDTPRFAEYFFAATPIAEIAGLNIGSRPASRKKGQRIEDLRAIPWGFSWAQCRL
MLTGWYGMGSAIEAYLETGAPGAPRSRRGRLAQLREMARDWPAFRTLLSNMEMVLAKSDL
AIAARYAQLVPQRALREKIFGMISAEHARTLAMLKLLTRRELLADNPALQASLRERFAYI
DPLNYLQVDLIRRHRAAQKSPAAEADERVQRAIHLTINGIAAGLRNSG
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccagccgcccgcagtccgattcagcagaacccttgcgtcacgatatccggctg
ttaggccgattgctgggcgaagtcatcgccgaatgcgaaggcaagcgcgtcttcgacacc
atcgagaccctgcgccgcaccgccgtcaaattccgccgcgaaggcaacgccgccgacggc
aagctgctggagcaacgcgtcaagcacctgcagggcagcgaccccaactcggtggcgcgc
gccttcagctacttcctgcacctgtccaacatcgccgaggaccgcgaccagaaccgcagc
cagcgcgcccgcgccctggcaggcgatgcgcccgcgcgcggcagcctgcgcgacgcggtg
cagaccctgggccgccatggcgtgacgcccgcgcgcatccgccgcctgctggccgacgcc
tgcgtcatgccggtgctgaccgcccaccccaccgaagtgcagcgcaagagcacgctggac
gtgcatcgcgagatcgcggccgcgctggtccagcgcgacaacccgctgacgccggaagaa
ctggccgaactcgacgccgcattgctcggccgcgtggccacgctgtggcagacgcgcatg
ctgcgctacacccgcctgacggtggccgacgagatcgagaacgcgctgtcgtactaccgc
agcaccttcctgcaggtcatcccgcgcgtctacggcgacctgtccaagctgctcaaccgc
gacgccaagccgttcggcgcgcccccgccgccgctggagccgttcctgcgcatgggcagc
tggatcggcggcgaccgcgacggcaacccgaacgtggatgccggcacgctggaacgcgcg
ctgctgcgccaggccaccgtgctgttcgagcactacctgcaggaagtgcacgcgctgggc
gccgagctgtccatcaccacgctgctgatcgcggtcgacccggccttgctggcgctggcc
gagcacagcggcgacgactcgccgcatcgcagcgacgagccctaccggcgcgcgctggtc
ggcgtctacgcgcgcctggccgccaccgcgctgcgcctgaccggacaggacctggcgcgc
cgcagcaccgtcgcggcacaaccctacggcacgccgcaggaactgtcggcggacctggcc
gtcatcgcggcgtcgctgtccgcgcaccatggcgcgcccatcggcaagttgcgcctggcg
gggctgcaacaagcggtcgaggtcttcggcttccatctcgccacggtcgacctgcggcag
agctccgacgtgcacgagcgcgcgctggccgagctgttcagccgcgccggcgccacccgt
gacggccagccgctggactacctggcgctggacgaagacgcgcgcgtggccctgctgcgc
gccgaactggcgcaggcgcggccgctggcctcgccctggatcgcctacagcgaagacacc
acgcgcgaactggcggtgctgcgcgcggccgccgccggccgccagcgctatggcaagcag
gccgtgcgccagaccatcgtctcgcacaccgaaacgctcagcgacctgctggaagtgatg
gtgctgcaaaaggaagcgggcctgatcgcgcccgccggccaggacatcccgccggaagac
ggcctgatggtggtgccgctgttcgagaccatccccgacctgcagcgcggcgccgacatc
atggccgcctggctcgacctgcccgagatccgcgagcgcgtgaaacgcgcccagaatggc
gcccaggaagtcatgctgggctactcggacagcaacaaggacggcggctttctcacctcc
aactggtcgctctaccaggccgaacgcgcgctggtggacgtcttctccagccgccacgtg
cgcctgcgcctcttccatggccgcggcggctcggtgggccggggcggcggctccagcttc
gacgccatcctggcgcagccgccgggcacggtggctggccagatccgcctgaccgaacag
ggcgaagtcatccagagcaagtacaaggacgccgaggtcggccgctggcacctggagctg
ctggtcgccgccacgctcgaatccagcctggcgccgcgcgccgaggccaccagcgcggaa
gacgcgcacatggcgcagcacggcccggccatgtcgttcatgtccgagaccgcgcagcgc
agctaccgcggcctggtgtatgacacgccgcgctttgccgaatacttcttcgccgccacc
cccatcgccgagatcgccgggctgaacatcggctcgcgccccgcctcgcgcaagaagggc
cagcgcatcgaagacctgcgcgccattccctggggcttttcctgggcccaatgccgcctg
atgctgaccggctggtacggcatgggctcggccatcgaggcctatctggagaccggcgcg
ccgggagcgccgcgctcgcggcgcggccgcctggcgcaactgcgcgagatggcgcgggac
tggccggccttccgcaccctgctgtccaacatggagatggtgctggccaagtccgacctg
gccatcgccgcgcgctatgcgcagctggtgccacagcgcgcgctgcgcgagaagatcttc
ggcatgatcagcgctgaacacgcccgcaccctggccatgctcaagctgttgacccggcgc
gagctgctggccgacaaccccgcgctgcaggcctcgctgcgcgagcgcttcgcttacatc
gacccgctcaactacctgcaggtcgacctgatccgccgccaccgcgccgcgcagaagtcg
cccgccgccgaggccgacgaacgcgtgcaacgcgcgatccacctgaccatcaacggcatc
gccgccgggttgcgcaactcggggtga

DBGET integrated database retrieval system