KEGG   Achromobacter denitrificans: APT56_26740Help
Entry
APT56_26740       CDS       T04244                                 

Definition
(GenBank) hydrolase
  KO
K07025  putative hydrolase of the HAD superfamily
Organism
adt  Achromobacter denitrificans
Brite
KEGG Orthology (KO) [BR:adt00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    APT56_26740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like C_LFY_FLO HAD
Motif
Other DBs
NCBI-ProteinID: ALX86492
LinkDB All DBs
Position
5975171..5975917
Genome map
AA seq 248 aa AA seqDB search
MRGLRTLLRPAVRQRRSRRTATGAPGRLWLFDLDNTLHDTSHAIFPRIDHGMTMAVAEAL
DVDIDTANAVRKQYWQRYGATMIGMVRNHGIDPHAFLHRSHDFDVNPLVRAEKALAYKLR
QLPGRKVLLTNAPLHYARAVMRRLGILRQFDSLWAIEHMRLHGEFRPKPSPALLRYVLAR
EGVPARQAVLVEDTLANLRGARRAGLRTVHVFHPGTPFARGRAQRPSYVDLRVNSVSDLL
LRRRPLRG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcgagggctgcgcaccctgctgcggccggcggtgcgccagcgccgctcgcgccgcacc
gccacaggcgcccccgggcgcctgtggttgtttgacctggacaacacgctgcacgacacg
tcgcacgccatctttccgcggatcgaccacggcatgacgatggccgtggccgaggcgctg
gacgtggacatcgacaccgccaacgcggtgcgcaagcagtactggcagcgctacggcgca
acaatgatcggcatggtgcgcaaccatggcatcgacccgcacgccttcctgcaccgcagc
cacgatttcgacgtcaacccgctggtgcgcgccgagaaggcactggcctacaagctgcgg
caactgccgggccgcaaggtgctgctgaccaacgcgccgctgcattacgcgcgcgcggtg
atgcgccggctgggcatcctgcgacagttcgacagcctgtgggccatcgagcacatgcgc
ctgcatggtgaattccgccccaagccatcgccagcgctgctgcgctatgtgctggcgcgc
gagggcgtgccggcgcgtcaggcggtgctggtcgaggacaccctggccaacctgcgcggc
gcgcgccgcgccggcctgcgcacggtgcacgtgttccatcccgggaccccgtttgcgcgc
ggccgcgcgcaacggccgtcgtatgtcgacttgcgggtaaactccgtcagtgatttgctg
ctgcgccgacgccctttgcggggttga

DBGET integrated database retrieval system