KEGG   Arachis duranensis: 107459120Help
Entry
107459120         CDS       T04300                                 

Definition
(RefSeq) enoyl-[acyl-carrier-protein] reductase [NADH], chloroplastic
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
adu  Arachis duranensis
Pathway
adu00061  Fatty acid biosynthesis
adu00780  Biotin metabolism
adu01100  Metabolic pathways
adu01212  Fatty acid metabolism
Module
adu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:adu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    107459120
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    107459120
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    107459120
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:adu01004]
    107459120
Enzymes [BR:adu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     107459120
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     107459120
Lipid biosynthesis proteins [BR:adu01004]
 Fatty acid synthase
  Component type
   107459120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-GeneID: 107459120
NCBI-ProteinID: XP_015932815
LinkDB All DBs
Position
A07
AA seq 389 aa AA seqDB search
MATTPFSGLQTAMSRSCIPSSQRSSVMAISGKSMVGSWNKLASVCHVSSVQPFQRVFTSS
TIKFERIVTKAMSDSSQKSLVSGLPIDLKGKRAFIAGVADDNGYGWAIAKSLAAAGAQIL
VGTWVPALNIFESSLRRGKFDESRVLPDGSLMEITKVYPLDAVFDNPEDVPEDIKTNKRY
AGSSKWTVQVFFLSVKEDFGTIDILVHSLANGPEVTKPLLETSRNGYLAALSASSYSYVS
LLKHFLPIMNPGGSSISLTYIASEKIIPGYGGGMSSAKAALESDTRVLAFEAGRKRKIRV
NTISAGPLRSRAAKAIGFIDMMIDYSIANAPLQKELSADEVGNSAAFLASPLASAITGTV
LYVDNGLNAMGVGVDSPVFKDLDIPKDQH
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaacaccgttttctggcctgcaaacggcaatgtcaaggtcatgtattccttca
tcacaaaggtcaagcgttatggctatttctggaaagtccatggtgggatcatggaacaaa
cttgcaagtgtgtgtcatgtttcatctgtgcagcctttccagcgggtttttacatcatct
accataaaatttgaaagaattgttacaaaggcaatgtctgattctagtcaaaagagtctg
gtttcaggattaccaattgacttgaaaggcaaaagggcttttattgccggtgtggctgat
gacaacggatatggatgggcaattgcaaaatctctcgctgcagcaggagctcaaatttta
gtcggcacatgggtacctgctttgaatatctttgagtcaagcttgcgacgtggaaaattt
gatgagtcacgcgtgttaccagatggttcattaatggagatcactaaagtttatcctttg
gatgccgtctttgacaatcctgaggatgtaccagaagatataaaaacaaacaagcgatat
gctggatccagtaaatggacagttcaggtattttttttatctgttaaagaagacttcggc
accatagacatccttgtccattcacttgcaaatggacctgaggtgactaaaccactgttg
gagacatcgcggaacgggtatcttgctgctttatccgcatctagttactcctatgtttct
ttactcaaacattttcttccaatcatgaacccaggtggatcttcaatttctctgacatac
atcgcttccgagaagatcattccagggtatggtggtggtatgagttctgctaaggctgca
ctagaaagtgacactcgagtgctcgcttttgaagctgggagaaagcgcaagattagagtc
aatactatttctgctggtccgctgagaagccgtgctgcaaaagcaattggattcatcgat
atgatgattgattattcaatcgccaatgcacctctacagaaagaactatcagcagacgag
gttggtaactcggcagccttcttagcgtcaccactggcatctgcgataactggtactgtt
ctatatgttgacaacggtctcaatgctatgggtgttggagttgacagtccagtatttaaa
gaccttgacattcccaaggaccagcattag

DBGET integrated database retrieval system