KEGG   Arachis duranensis: 107459820Help
Entry
107459820         CDS       T04300                                 

Definition
(RefSeq) ent-kaurene oxidase, chloroplastic
  KO
K04122  ent-kaurene oxidase [EC:1.14.14.86]
Organism
adu  Arachis duranensis
Pathway
adu00904  Diterpenoid biosynthesis
adu01100  Metabolic pathways
adu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:adu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    107459820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:adu00199]
    107459820
Enzymes [BR:adu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.86  ent-kaurene monooxygenase
     107459820
Cytochrome P450 [BR:adu00199]
 Cytochrome P450, plant type
  CYP701 family
   107459820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 DUF5411
Motif
Other DBs
NCBI-GeneID: 107459820
NCBI-ProteinID: XP_015933578
LinkDB All DBs
Position
A07
AA seq 519 aa AA seqDB search
MQMDTLALIQAQPFAASLAVVAVSLFLFLYLLNGSRTPAAASLVVGLATSLPKVTVVPGL
PIVGNLLQLKDKKPYKTFVQFAQKYGPIYSIRTGASTIIVLNSAHLAKEAMITRYSSISS
RKLSNALTILTSNKCMVAISDYNDFHKMVKKLILANVLGPNAQKRHRLHREEMVENMSRQ
FNEHVKNSSDSPINFRDIFSSQLFGLAMKQGVGSDVESIYVDDFGNKISRKDMYQILVVD
IMEGAIEVDWRDFFPYLRWIPNRSMETKIQRMCFRRKAVMKALINEQKKRIASGKKVNCY
IDYLLSEAKELTEDQIMMLLWETIIETSDTTLVTSEWAMYELAKDKTRQDRLYSELRDAC
GNERVTEDHLAKLPYLGAVFHETLRKHSPAPIVPLRHVDEDTQIGGYHIPAGSEIAINIY
GCNMDEELWENPEQWMPERFLDDEKYETMDLFKTMAFGAGKRVCAGALQANLIACSSIGR
LVQEFEWELAQGEEENVDTVGLTTHRLHPLLVKIKPRSK
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatggacactctggcccttattcaggcacagccctttgctgcctcccttgcggtc
gttgctgtctcgcttttcctttttctttacctattaaacggtagccgcactcccgcagct
gcctcacttgtggttggtcttgctacttctcttcctaaagtaacagtggttccgggttta
ccgattgttggtaatctgctgcagttgaaggataagaagccgtacaagacattcgtacag
tttgcccaaaaatatggtcctatatattccatcaggaccggtgcttccaccattattgtt
ctcaactctgcccatcttgctaaggaggccatgattaccagatattcatcgatttcatca
aggaagctgtcgaatgcattaacaattctgacttccaataaatgtatggttgctataagt
gactacaacgactttcacaaaatggtcaaaaaacttattcttgcaaatgttctcggaccc
aatgcacagaagcggcatcgtctccacagagaagaaatggtggaaaacatgtctaggcag
tttaatgaacatgtgaagaactcctctgattccccgattaattttagggatatattttct
tctcaactttttggattggcaatgaagcaaggtgtaggaagtgatgtggaatccatttat
gtggatgattttggaaataaaatatcaaggaaggacatgtatcaaattctagtggttgat
ataatggagggtgcaattgaggttgattggcgagatttcttcccatacttgagatggatt
ccaaataggagcatggagacaaaaattcagagaatgtgcttccgcaggaaagcagttatg
aaagcattgatcaatgagcagaagaagagaattgcttccggaaagaaagtgaattgttac
attgactacctgttatcggaagccaaggagctaaccgaagaccaaattatgatgcttctt
tgggagaccatcatagagacttcggatactacattagttacgtccgaatgggctatgtat
gaacttgctaaagacaaaacacgtcaggatcgattatattcggagctccgagatgcatgc
gggaatgagagggtaacagaagaccatttggctaagctgccgtatttaggggctgtattc
catgaaactctgaggaagcacagtccagctcccattgtcccactgaggcatgtcgatgaa
gatacccaaataggaggatatcacattcccgctgggagcgagattgctataaacatatac
gggtgtaacatggacgaggaactgtgggaaaatcctgagcagtggatgccggagaggttt
ctggatgatgagaagtatgagaccatggatctgttcaagacaatggcatttggggcgggg
aagagggtgtgcgcaggggctttgcaggcgaatctgatagcgtgctcgtcaattgggaga
ctggttcaggaattcgaatgggagctggctcaaggcgaggaggagaatgttgacacagtc
ggccttaccacccacaggttgcatcccctccttgtcaaaatcaagccaagaagcaaatga

DBGET integrated database retrieval system