KEGG   Arachis duranensis: 107460261Help
Entry
107460261         CDS       T04300                                 

Definition
(RefSeq) SWI/SNF complex subunit SWI3B
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
adu  Arachis duranensis
Brite
KEGG Orthology (KO) [BR:adu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:adu03021]
    107460261
   03036 Chromosome and associated proteins [BR:adu03036]
    107460261
Transcription machinery [BR:adu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     107460261
Chromosome and associated proteins [BR:adu03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    107460261
   PBAF complex
    107460261
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SWIRM Myb_DNA-binding SWIRM-assoc_1 Myb_DNA-bind_6 Myb_DNA-bind_7 Fic_N
Motif
Other DBs
NCBI-GeneID: 107460261
NCBI-ProteinID: XP_015934099
LinkDB All DBs
Position
A08
AA seq 491 aa AA seqDB search
MATNSPATAPPPPKPGDPPSSSTETTPPPPKQPPQPSPSPAKPEAPLSDSKPSTEATVVL
VPSHSRWFSLHSIHQCEVRHLPEFFDSPSSSSKNPRVYKYYRNSIVKYFRYNPSRKITFT
DVRKTLVGDVGSIRRVFDFLEAWGLINYLPSSSMNKPLKWDDKESKSESGSNTAEPPQPV
RENTKRICSGCKAVCTIACFACDKYDLTLCARCYVRGNYRVGVSSSDFRRVEISEETKTD
WSEKETLNLLEAVTHYGDDWKRVSQHVGGRTEKDCVAHFIKLPFGDQFLRYRDGGATDDT
ANQLRQNAAVAEFDSEAGGAAEHSKRMRLTPLADASNPIMAQAAFLSALAGSEVAYSAAQ
AAVATLSEAYKTTKNHRSFPRNTSLQEAGIASNGGTSSDSSQASRFHANILLEKEELDVE
KAISEIIEVQMKNIQDKLLRFENSDLMIEKECQQLEQMKNLLFLDQLSLLFQKQSASKSG
ERTEGNGVKTN
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaactctcccgccacagctccgcctccacccaaaccgggtgaccctccttct
tcctccaccgaaaccacaccgccccctcccaagcaaccaccacagccctcaccttctccg
gcgaagcccgaagccccattgtccgactcaaaaccctccacagaagccaccgtcgtgctg
gtccccagccactccagatggttctccttacattccattcaccaatgcgaggtccgccat
ctccccgagttcttcgactccccctcttcctcctccaagaaccctagggtttacaagtac
tacaggaactccatagtcaagtacttccgttacaacccttcccgaaaaatcaccttcacc
gacgtcagaaaaaccctcgtcggtgacgtcggttccatccgcagagtcttcgatttcctc
gaagcatggggattgatcaattaccttccgtcttcgtccatgaacaagcccttgaagtgg
gacgacaaagagtccaaatccgaatctggatccaacactgccgaacccccacaacctgtt
cgagaaaacaccaagagaatctgcagcggatgcaaagccgtttgcaccattgcttgcttt
gcttgtgataagtatgatttgactctgtgtgcgagatgctatgttcgtgggaattataga
gtgggtgtgagttcttcggattttaggcgagttgagataagcgaagagactaagacggat
tggagtgagaaggagactctgaatcttctggaagccgttacacattatggtgatgactgg
aagagagtttcccagcatgttggtggcaggacagagaaggactgcgttgctcatttcatc
aagcttccttttggggaccagttcctgcgttatcgagatggtggtgcgactgacgacact
gcaaatcagctgaggcagaatgctgctgtagccgaattcgattcagaagctggtggtgca
gccgagcatagtaaaagaatgcgactcacccctcttgccgatgcaagcaaccctattatg
gctcaggctgcttttctgtcagctctggctggatcagaggttgcatattctgctgcacaa
gctgcagtggcaactctctcggaggcttacaaaacaactaaaaatcatcgatcattccca
agaaacacatcactacaagaagctggtattgcatctaatggtggtacctcttcagattca
tcacaagcatctcgatttcatgcaaatatactgctcgaaaaagaagagttagatgtggaa
aaggcaatttctgagattattgaagttcagatgaaaaatatccaagacaagcttcttcgt
tttgagaattcagacttgatgatagagaaagaatgccagcagttggagcaaatgaagaac
ttgcttttccttgatcagctttctcttttatttcaaaagcaatctgcttcaaaatctgga
gaacgcacagaaggcaatggtgtaaagacaaattga

DBGET integrated database retrieval system