KEGG   Arachis duranensis: 107461437Help
Entry
107461437         CDS       T04300                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: beta-galactosidase 17
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
adu  Arachis duranensis
Pathway
adu00052  Galactose metabolism
adu00511  Other glycan degradation
adu00531  Glycosaminoglycan degradation
adu00600  Sphingolipid metabolism
adu00604  Glycosphingolipid biosynthesis - ganglio series
adu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107461437
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    107461437
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    107461437
   00604 Glycosphingolipid biosynthesis - ganglio series
    107461437
   00511 Other glycan degradation
    107461437
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:adu04147]
    107461437
Enzymes [BR:adu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     107461437
Exosome [BR:adu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107461437
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 107461437
NCBI-ProteinID: XP_015935412
LinkDB All DBs
Position
A08
AA seq 690 aa AA seqDB search
MIIGVKKRNVNAASASSASKLLAMAKKRSSKATLLLIFISFTALYAFLPVLAPLPSLSSS
SHHNKVNRNFEISRDMFWKDSQPFQIIGGDLHYFRVHPQYWEDRLLKAKALGLNTIQTYV
PWNLHEPSPGRHVFEGFADIESFLKLCNKLGLLVMLRPGPYICAEWDWGGFPAWFSSMSP
SPKLRSSDPTFLHLVERWWGNLLPKLVPLLYQNGGPIIMVQIENEYGSYGNDKAYLQHLV
VLARSHLGPDIILYTTDGGARENLEKGTIRGDAVYSAVDFSTGDDPWPIFELQKKYNAPG
KSPPLSAEFYTGWLTHWGEKIAKTDADFTAASLEKILQKNGSAVLYMAHGGTNFGFYSGA
NTGSAEXIREDGDVDNSKYNAIRKVIARYSSVPLPSVPSNIQKTAYGPIHLQRKTFLFDE
FNFTSSTNVFESEQPMSMESVGQLFGFLLYVTQYKANGGIKTLLIPKLHDRAQVFISCPS
DVTGARPSYVGAIERWSNNKLNLPNLKCHSNINLLILVENMGRVNYGPYIFDGKGILSSV
YLDGEILHRWKMFPIPLHNLNEVPTHNGIMQVAYSARGKRLTSKYENTSREPAFYSGHFS
IDKSSEVKDTYISFNNWGKGIAFVNDFDIGRYWPLRGPQCNLYVPAPVLKQGNNYLVILE
LESPDPELVVHSVDEPDFTCSFGNMNLHQL
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgataatcggagtgaagaagagaaacgtgaacgctgcatcagcttcctcagcttcgaaa
ctgttggcaatggcgaagaaacgaagctctaaagctacgcttttactcatcttcatctcc
ttcacagctctctatgctttccttcctgtcttggctcctcttccttctctctcctcctcc
tctcaccacaacaaagttaacagaaactttgagatttcccgcgatatgttctggaaagat
tctcaaccctttcagatcattggcggtgacttgcactattttcgagtgcatccacagtac
tgggaagatagactcttaaaagccaaggcattgggattgaacacaattcaaacttatgtt
ccctggaatttacatgaaccaagccctggacgccatgtttttgagggttttgctgacatt
gaatctttcctcaaactctgtaacaaactaggtctacttgtcatgcttagacctggtcca
tacatatgtgcagagtgggattggggtggtttccctgcttggttctcttccatgagccca
tcccccaagctaaggtcatccgatcctacttttcttcatctggttgaaagatggtggggt
aacctgcttccaaaattggttcctctcctatatcaaaatggaggtccaataataatggtt
cagattgaaaatgagtatggttcatatggaaatgacaaagcatatctccaacaccttgtc
gtgctggctagaagtcatctcggacccgatatcattttatacactacagatgggggggct
agggaaaatcttgagaaaggaactattcgtggggatgcagtctattcagctgttgacttc
agtactggtgatgatccttggcctatattcgagttacaaaagaagtacaatgcccctgga
aaatcaccgccattgtcagctgaattttacactgggtggcttacacattggggggagaaa
attgccaagactgatgctgattttacagcagcttcccttgagaaaattctgcaaaaaaat
ggttcggcagtcttatatatggcacatggaggtacaaactttgggttttatagtggagca
aatactggttctgctgagngcattagagaagatggagatgttgacaactcaaaatataat
gctattcggaaggttatagcacgatatagctcagtgccccttccatctgttccatctaat
attcaaaagacagcatatggaccaattcacttgcagcggaaaactttcttatttgatgaa
tttaattttaccagttccaccaatgtctttgaatctgaacaaccaatgtcaatggagtct
gtgggccagttgtttggattcttgttatatgtcacccagtacaaagcgaatggaggcata
aaaactttgcttataccaaagttgcatgacagagctcaagtatttatatcatgcccttct
gacgtaactggtgcaaggccatcttatgttggtgccatagaaagatggtcaaataacaaa
ctcaaccttcctaatcttaaatgccattctaacatcaacttattgattctggtggaaaac
atgggtcgtgtaaattatggaccttacatctttgatggaaagggcattctttcctctgtt
tatctggacggggaaatattacacaggtggaaaatgttccctattcctttgcacaatctc
aatgaagtgccaacccacaatggcatcatgcaggttgcatattctgcacgtggaaaaaga
ttgacgagtaagtatgagaatacttcaagagagcctgcattctattcaggtcatttctca
attgacaaatcaagtgaggtcaaggatacatacatatcattcaacaactggggcaaaggc
attgcatttgttaatgactttgatataggaagatattggccgttgagaggaccacagtgc
aacctctatgttcctgctccagttcttaagcaaggaaataattatctggtcatcctggag
ttggaatctccagaccctgaacttgttgtacacagtgttgatgagccagacttcacgtgc
agttttggtaatatgaatctccatcagctttaa

DBGET integrated database retrieval system