KEGG   Arachis duranensis: 107462399Help
Entry
107462399         CDS       T04300                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
adu  Arachis duranensis
Pathway
adu00620  Pyruvate metabolism
adu00710  Carbon fixation in photosynthetic organisms
adu01100  Metabolic pathways
adu01200  Carbon metabolism
Module
adu_M00168  CAM (Crassulacean acid metabolism), dark
adu_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
adu_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
adu_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:adu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    107462399
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    107462399
Enzymes [BR:adu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     107462399
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 107462399
NCBI-ProteinID: XP_015936454
LinkDB All DBs
Position
A08
AA seq 968 aa AA seqDB search
MAATSRNIEKMASIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILQDLHGEDIRQTVQ
DCYELSAEYEGKHKTEKLEELGNMLTGLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRR
IKLLKKGDFADENSAITESDIEETFKRLVTELKKSPQEVFDALKNQTVDLVLTAHPTQSI
RRSLLQKHGRIRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRSPPTPQDEMR
AGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPE
VTRDVCLLARMMAANLYFSQIEDLMFELSMWRCNDELRVRADELHVSSRRDAKHYIEFWK
QIPPNEPYRVILGDVRDKLYNTRERARQLLANGTSDIPEETTFTNVEQFLEPLELCYRSL
CACGDRPIADGSLLDFLRQVSTFGLSMVRLDIRQESDRHTDVMDAITKHLEIGSYREWSE
ERRQEWLLSELSGKRPLFGPDLPKTEEIADVLETFHVIAELPSDNFGAYIISMATAPSDV
LAVELLQRECHVKQPLRVVPLFEKLADLESAPAAVARLFSIDWYRNRINGKQEVMIGYSD
SGKDAGRLSAAWALYKAQEELIKVAKDFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPET
IHGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRVLLDEMAVI
ATKEYRSIVFQEPRFVEYFRCATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQ
TRFHLPVWLGFGSAFKHAIEKDPKNLLMLQDMYNQWPFFRVTLDLIEMVFAKGDPGIASL
YDKLLVSEELLPFGERLRTKYEETKSFLLQVAGHRDLLEGDPYLKQRLRLRDSYITTLNV
LQAYTLKRIRDPDYHVKLRPHLSKEFMESSKPAAELVKLNPKSEYAPGLEDTLILTMKGI
AAGMQNTG
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atggcagctactagtaggaacattgagaagatggcttcaattgatgctcagctgaggttg
ctggcaccaaggaaggtttctgatgatgacaagcttgttgagtatgatgctttgttgctt
gatcgattccttgacattcttcaggatttgcatggtgaagatatcaggcaaacggttcaa
gattgttatgagctttcagctgagtatgaagggaagcataagactgagaagttggaggaa
cttgggaatatgctaactggtcttgatgctggggattctattgtcattgccaaatcattt
tcccacatgcttaatttggctaacttggcagaagaagtccaaattgcctaccgaagaagg
attaagctattaaagaagggcgattttgctgatgagaactctgccatcactgaatctgac
attgaagaaaccttcaagaggcttgtgactgaactgaagaagtccccacaggaagtgttt
gatgctttgaagaaccaaactgtagatttggtcctaactgctcatcccactcagtccatt
cgtcgatctctgctgcaaaagcatggaaggataaggaactgtctgacacagttgtatgcg
aaagacataacaccggatgataagcaggaacttgatgaggctctccaaagagagattcaa
gctgcatttcgcacagatgaaattcgaaggagtcctccaacaccacaagatgagatgagg
gcaggaatgagctactttcatgagacaatatggaaaggtgtaccaaagtttttgcgccgt
gttgacacagctctgaagaacatcggaataaatgagcgtgtcccatacaatgcccctctt
attcaattctcttcttggatgggaggagatcgtgatggtaaccctagggtaacccctgaa
gttacaagggatgtgtgtttgctggctagaatgatggctgctaatttatacttctctcag
atagaagatctcatgtttgagttgtctatgtggcgctgcaatgatgagcttcgtgttcgt
gctgatgaactccatgtgtcctcaaggagagatgcaaaacattacattgaattttggaag
cagattcctccaaatgagccatatcgtgttattcttggtgatgtgagggacaaactatac
aatacacgcgaacgtgctcgccagttattagccaatggaacctctgacatccccgaagag
acaaccttcacaaatgttgagcagttcctggagccccttgaactctgctatagatcactc
tgcgcatgtggtgatcgaccaatagcagatggtagccttcttgatttcttgcggcaagtt
tccacatttggactctcaatggtaagactcgacattcgtcaagagtcagaccggcacact
gatgtcatggatgccattaccaaacacttggagattggatcataccgagagtggtctgag
gaacgcaggcaggaatggcttctgtcagagctcagtggaaagcgccctctgttcggccct
gatcttcccaaaacagaagagatcgccgatgttctggaaaccttccatgtcattgcagaa
cttccctcagacaactttggtgcctacataatctcaatggcaacagcaccgtctgatgtg
cttgctgttgagctcttacaacgggaatgccatgtgaagcaaccgctaagggtcgtgcca
ttgtttgaaaagcttgctgatcttgagtctgctcctgctgcagtggcgcggcttttctct
attgattggtacagaaaccgaatcaatgggaagcaagaagttatgataggatactcagac
tcaggaaaagatgccggtcgtctttctgcggcttgggcgctgtacaaggctcaagaggag
ctcataaaggttgcaaaggatttcggtgttaagctgacaatgttccatggcagaggaggg
actgttggaagaggaggcggccccactcaccttgctatattatctcagccaccagaaacc
attcatggctcacttcgggtgacagttcaaggtgaagttattgaacaatcctttggagag
gagcacttgtgctttagaactctccagcgattcactgctgctacacttgagcacggaatg
caccctcccgtgtcacccaaaccggaatggcgagtgctgctagatgagatggctgtcatt
gcaacgaaggagtatcgctccattgttttccaggaaccccgttttgttgaatacttccga
tgtgctacccctgagttggagtatggacgaatgaacattggaagtcgtccatcaaagaga
aagccgagtggaggaatcgaatcactgcgtgctattccatggatttttgcttggacacaa
acaaggtttcatttgccagtgtggcttggctttggttctgcatttaagcatgcaattgag
aaggatccaaagaatctcctaatgcttcaagatatgtacaaccagtggcctttcttcagg
gtcaccctggacttgatcgagatggtgttcgccaagggagacccggggatcgcttccctg
tacgacaaactcctagtgtcagaagagctgttgccattcggagagcgcttgaggactaaa
tatgaagaaaccaagagttttctccttcaggttgctgggcacagggatcttcttgaaggt
gacccctacttgaagcaaaggcttcgtctccgcgattcatacatcacaaccctgaatgtg
ttacaagcctacacgttgaagagaatccgcgaccccgactaccatgtcaagttgaggcca
catttgtcaaaggaattcatggaatcaagcaagccagctgcagaacttgttaaactcaac
ccaaaaagtgagtatgctcctggtttggaggacacacttatcttgacaatgaagggtatt
gctgctggcatgcaaaacacaggttaa

DBGET integrated database retrieval system