KEGG   Arachis duranensis: 107462832Help
Entry
107462832         CDS       T04300                                 

Definition
(RefSeq) probable enoyl-CoA hydratase 1, peroxisomal
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
adu  Arachis duranensis
Pathway
adu00071  Fatty acid degradation
adu00280  Valine, leucine and isoleucine degradation
adu00310  Lysine degradation
adu00360  Phenylalanine metabolism
adu00380  Tryptophan metabolism
adu00410  beta-Alanine metabolism
adu00640  Propanoate metabolism
adu00650  Butanoate metabolism
adu00903  Limonene and pinene degradation
adu01100  Metabolic pathways
adu01110  Biosynthesis of secondary metabolites
adu01212  Fatty acid metabolism
Module
adu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:adu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    107462832
   00650 Butanoate metabolism
    107462832
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107462832
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107462832
   00310 Lysine degradation
    107462832
   00360 Phenylalanine metabolism
    107462832
   00380 Tryptophan metabolism
    107462832
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107462832
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    107462832
Enzymes [BR:adu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     107462832
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 107462832
NCBI-ProteinID: XP_015936998
LinkDB All DBs
Position
A01
AA seq 262 aa AA seqDB search
MDRSSSENLILVNREPNGVAIITINRPGSLNSLTRPMMVDLAQAFKALDQDHSVKVIILT
GSGRSFCSGVDLTAAEDVFKGDVKDPESDPVIQMDRCRKPIIGAIKGFAITAGFEISLAC
DILVAAKGSKFIDTHARFGIFPSWGLSQKLSRIIGVNKAREVSLTATPLTAEVAEKLGFV
NHVVEDSEVLKKSREIAEAIMKNNQDLVLRYKSVINDGIKLDLGRALSLEKERAHDYYNG
MTKEQFKKMQEFIAGRKKPSKL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggaccggtcctcatcggagaatctaattcttgtaaaccgggaaccaaacggcgtcgct
atcataaccattaaccgccccggatctctcaactctctcacccgccccatgatggtggac
cttgctcaggccttcaaggccctcgaccaagaccactccgtcaaggtcatcatactcacc
ggctccggccgatcattctgctccggtgtcgacctaaccgccgccgaggacgtcttcaag
ggcgacgtcaaggaccccgaaagcgaccccgttattcaaatggatcgctgccggaagccc
ataatcggagccatcaagggattcgccatcaccgccgggttcgagatttcactcgcctgt
gacatcttggtcgccgccaaaggatccaagttcatagacacccacgccaggtttgggata
tttccttcgtggggcttgtctcagaagctttcgcggatcataggagtcaataaggcacga
gaggtatccctgacggcgacgcctttgacggcggaggttgctgagaaattgggttttgtg
aatcatgtcgttgaggacagtgaagtgttgaagaaaagcagagaaattgcagaagccata
atgaaaaacaatcaggacttggtgttgagatacaaatccgtcataaacgacggcatcaag
cttgatcttggccgtgctctttcgcttgaaaaggagagagctcatgattattacaatgga
atgacaaaggagcaattcaaaaagatgcaggaattcatagctgggagaaagaaaccgtcc
aaattgtag

DBGET integrated database retrieval system