KEGG   Arachis duranensis: 107466048Help
Entry
107466048         CDS       T04300                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH3 isoform X2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
adu  Arachis duranensis
Pathway
adu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:adu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107466048
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:adu03036]
    107466048
Enzymes [BR:adu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107466048
Chromosome and associated proteins [BR:adu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107466048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF682
Motif
Other DBs
NCBI-GeneID: 107466048
NCBI-ProteinID: XP_015940516
LinkDB All DBs
Position
A09
AA seq 349 aa AA seqDB search
MPTMKKNSEQTSFGLVFSKLAEEIGEPVDFELPEWFNKCKPMPVTFIKRNIYLTKRVKRR
LDDDGIFCSCTSSPGSSAVCGKDCHCGMLLSSCSSGCKCGVSCLNKPFQHRPIKKMKLVQ
TEKCGSGIVADEDIKQGEFVIEYVGEVIDDKTCEERLWNMKLRGVTNFYLCEINRDMVID
ATYKGNKSRYINHSCCPNTEMQKWIIDGETRIGIFATRDIRKGEHLTYDYQFVQFGADQD
CHCGANMCRRKLGVKPTKPKTSSDAALNLFGDQVYQNGGLHIGNSRLFCQSNCLRNCIGE
VVRIRHLDIIRFGIIKRFHEYSKKHSIMFEDGRVEFFDMSKEDWELVTL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccatgaagaagaattctgaacaaacatcctttgggttagtatttagcaaattg
gcagaggagattggtgaacctgtcgactttgaacttccagaatggtttaataagtgcaag
ccaatgccagtaacatttataaaacgcaatatatatctgacaaaaagggttaaaagaagg
cttgatgacgatggcatattttgttcttgtacatcatcacctggatcttctgctgtatgc
ggtaaagattgccactgtgggatgcttctgtctagctgctcttcaggctgtaaatgtggg
gtttcctgtcttaacaaaccattccagcatcgacccatcaaaaagatgaaattagttcag
actgagaaatgtggttctggaattgtggcggatgaagatatcaagcaaggagaatttgtg
atagaatatgttggagaagtcattgatgacaaaacatgtgaagaaagattatggaacatg
aaacttcgtggggtgacaaacttctacctatgtgaaataaatcgagatatggtgatcgat
gcaacatataaaggaaacaaatcaagatatatcaatcatagttgctgtcctaatactgag
atgcagaaatggataattgacggtgaaacgagaattggcatattcgcaacgcgcgacata
aggaaaggcgaacatctgacatatgattatcagtttgtccagtttggtgccgatcaggat
tgccactgcggggctaatatgtgcaggcgtaagcttggtgtgaaacctaccaagcctaaa
acttcttcagatgctgcattaaatttattcggagaccaggtttatcagaatggaggtttg
catattggaaattcccgcctcttttgccaatcaaactgccttcgcaattgcattggtgaa
gttgttagaatcagacaccttgatatcataaggttcgggattattaagcggtttcatgaa
tattcgaagaaacactccatcatgtttgaggatggacgtgtcgaattttttgacatgtcc
aaggaagattgggaactggttacattgtga

DBGET integrated database retrieval system