KEGG   Arachis duranensis: 107467488Help
Entry
107467488         CDS       T04300                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
adu  Arachis duranensis
Pathway
adu00010  Glycolysis / Gluconeogenesis
adu00020  Citrate cycle (TCA cycle)
adu00620  Pyruvate metabolism
adu01100  Metabolic pathways
adu01110  Biosynthesis of secondary metabolites
adu01200  Carbon metabolism
Module
adu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:adu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107467488
   00020 Citrate cycle (TCA cycle)
    107467488
   00620 Pyruvate metabolism
    107467488
Enzymes [BR:adu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     107467488
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 107467488
NCBI-ProteinID: XP_015942089
LinkDB All DBs
Position
A09
AA seq 475 aa AA seqDB search
MASSPSPFTLSFSSSVSSTSLLPCRRSFILPIPRGRATSFTVQSKIREIFMPALSSTMTE
GKIVSWIKSEGETLSKGESVVVVESDKADMDVETFYDGILAAIVVPDGETAPVGAPIALL
AETEEEVAEAKAKAAKSSQSQSSAPPPQPANPAPAISQPSPPPPPPPSAAASDGPKKTVA
TPQAKKLAKQHKVDLASLTGTGPFGRITPADVETAAGIAPSKSSPAPAAPAPASSAPPKA
AAAGAVAPPPIPGSSVVTFTTMQSAVAKNMVESLSVPTFRVGYPVITDALDALYEKVKPK
GVTMTAILAKAAAMALVQHPVVNASCKDGKNFAYNSNINIAVAVAINGGLITPVLQDADK
LDLYLLSQKWKELVNKARGKQLQPNEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVG
ASKPTVEADATGFFKVKNKMLVNVTADHRIIYGADLAAFLQTFSKIIENPDSLTL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttctccttcaccattcaccctctcattctcctcttccgtctcatccacatcc
ctcctcccatgccgtcgcagcttcattctcccaatccctcgaggccgcgctacctcattc
actgtccaatccaagatccgagaaatcttcatgcccgcactcagctccactatgactgag
ggcaaaatcgtctcttggatcaaatccgagggcgagactctctccaagggtgagagcgtc
gtcgtcgtcgaatccgacaaagctgacatggacgtcgagacattctacgatggaatactc
gccgccatcgtcgtccccgacggcgaaacagcccccgttggagctcccatcgccttactc
gccgagacggaggaagaagtcgccgaagccaaagccaaagctgccaagtcatcacaatcc
caatcctctgcgcctcctcctcagcctgcaaatccagctccggcaatttctcagccttct
cctcctcctcctcctccgccatcggcggcagcttctgacggaccgaagaagaccgtcgcc
acgcctcaggcgaagaagctcgcaaagcagcacaaggtagaccttgcgtctctcaccggg
actggtccgtttggtcggatcactccggccgacgtagagaccgctgccgggattgcgcca
tcaaagagcagtcctgctccggcggctcctgctccggcgagctcagctcctccaaaagca
gctgctgctggtgcagtggcgccgcctccaattccaggctctagcgttgttacattcacg
acaatgcaatctgcagttgcaaagaacatggtggagagcctctccgtgcctacattccgt
gttggttatcctgtgatcactgatgcacttgatgctttatatgagaaggtgaagccgaag
ggggtgacaatgacagcgattttggccaaggctgctgcaatggcacttgtccaacatcca
gtggtcaatgccagctgcaaagatggcaagaactttgcctataacagcaacatcaacatt
gcagttgctgtggcaatcaacggcggtttgattacccctgtacttcaggatgccgacaag
ttggacttgtatctgttgtcccaaaagtggaaagagctagttaataaagctcgtggaaag
caattgcaacccaatgagtataattcaggaactttcacactctccaatctgggcatgttt
ggagttgacaggtttgatgccatacttcctccagggcagggggctatcatggcagttgga
gcatcaaagcctactgtcgaggctgatgcaactggattcttcaaggtgaaaaataagatg
ctggtgaatgtaacagctgatcaccgaataatttatggtgctgatttggccgccttcctt
cagacattctccaaaatcattgaaaacccagacagtctaacattgtaa

DBGET integrated database retrieval system