KEGG   Arachis duranensis: 107471699Help
Entry
107471699         CDS       T04300                                 

Definition
(RefSeq) cytochrome P450 71D11
Organism
adu  Arachis duranensis
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 107471699
NCBI-ProteinID: XP_015946673
LinkDB All DBs
Position
A10
AA seq 531 aa AA seqDB search
MPVLNLSYRNLRLKLRQCFAYCCLYPKDSVIKKDELIQLWMVQGYLATLNIPPGPWKLPI
IGNIIPHLVTSTPHRKLRDLAIKYGPLMHLQLGEISAIVVSSPEYAKLVMKTHDVIFASR
PKFLFSEIVTYNCTDIAFSPYGNYWKLLRKVSTLELFSPKRVNSFKSIREEEFNSLVKRI
MIESKTQSMINLTEEVISTTYAIVSRAAFGSRCKDQEEFITVAKEVAMIGAGFDIGELFP
SSKWIQLVSGLRPKLQRLRTKSDRILRNIINDHKDVEEVQGGDDHDSNEDLVDVLLKFVD
DANGINQDICFTEDNIKAIILTIFTAGGETTATTIDWVMSEMMKNPRIMQKTQAEVRDIF
NKSGRVDETCIHELKYLNSVVKETLRLHPPLPLLLPRECGKQECEINGYHIPYKSKVIVN
VWAIGRDPNYWTEPEKFYPERFMENNSSIDYKGNNFEYLPFGGGRRICPASMFGIMNVEL
TLAFLLYHFDWKLPNEMKFDDVDMTEQVGITAKRKQDLNLIPIASCPLASL
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgccggtactaaatttgagttaccgaaacttacgacttaaactaagacaatgttttgct
tattgttgtctatatccaaaagattcggtaataaaaaaggatgaattgattcaattatgg
atggttcaaggatatcttgcaactttaaacatacctccaggaccatggaaactacccatt
ataggaaacataataccccatcttgttacatccacaccacatagaaaactaagagatttg
gccatcaaatatggaccactgatgcaccttcaacttggtgaaatctctgccattgttgtt
tcctctccagagtatgcaaagttggtaatgaaaacacatgatgttatctttgcttccagg
cctaaatttctattctcagagattgtgacatataattgcacagatatagctttctcacca
tatggaaattattggaagctactaaggaaagtttccacattagagcttttcagtccaaag
cgtgtgaattctttcaaatcaataagagaagaagagttcaatagtcttgtcaaaaggatt
atgattgagtcgaaaacacagagcatgatcaacctcactgaagaagtgatttcaacaaca
tatgcaatcgtttcaagggctgcgtttggatcaagatgcaaagatcaagaggagttcata
acagttgcaaaagaagtagcaatgattggggcgggttttgacataggagagttgtttcct
tcttccaaatggattcaacttgtgagtggtttgagacctaagcttcagaggttgcgaaca
aaaagtgataggatattgagaaacatcatcaatgaccacaaagatgttgaagaagtccaa
ggtggtgatgatcatgattcaaatgaagatcttgtagatgttctactaaaatttgtggat
gatgctaatggtatcaatcaagatatttgcttcactgaggacaacatcaaggctataatc
ctgaccatttttactgctggaggggagacaacagcaacaaccatagattgggtaatgtca
gagatgatgaagaatccaagaataatgcaaaaaacacaagctgaggttagggatatattc
aacaaaagtggaagggttgacgagacttgtatccatgaactcaagtatttgaactcagtt
gtgaaagaaacactaaggttacaccctccacttcccctcttacttccaagagaatgtgga
aaacaagaatgtgagatcaatggatatcacataccctacaaaagtaaggtgatagtgaat
gtctgggcaataggaagagatccaaactactggaccgaacctgagaagttttatccggag
agattcatggaaaataattcttctattgattataaaggaaataattttgagtacctccca
tttggaggtggaagaagaatatgtcctgcaagcatgtttggtataatgaatgttgagttg
acacttgcatttttgttgtatcactttgattggaagcttcccaatgaaatgaaatttgat
gatgtggatatgactgaacaagttggaattactgcaaaaagaaaacaagacctcaacctg
attcccattgcttcttgtccattagcttcattataa

DBGET integrated database retrieval system