KEGG   Arachis duranensis: 107474252Help
Entry
107474252         CDS       T04300                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial isoform X1
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
adu  Arachis duranensis
Pathway
adu00564  Glycerophospholipid metabolism
adu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:adu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107474252
Enzymes [BR:adu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     107474252
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 GIDA Pyr_redox Pyr_redox_3 HI0933_like 3HCDH_N NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 107474252
NCBI-ProteinID: XP_015949338
LinkDB All DBs
Position
A02
AA seq 632 aa AA seqDB search
MTATARLRRIGTAVVAAVATAYGGTILLVPPVSANDHGGGGSHLAAIRQKIHDPSATVPS
REVQRSSLIGTSPANPLDVLVIGGGATGSGVALDAVTRGLRVGLVEREDFSSGTSSRSTK
LIHGGVRYLEKAVFKFDYGQLKLVFHALEERKQVIDNAPHLCNALPCMTPCFDWFEVVYY
WIGLKMYDLIAGARLLHLSRFYSTEESVELFPTLAKEGKGRRLRGTVVYYDGQMNDARLN
VGLACTAALAGATVLNHAEVVSLLKDDIGERIIGAQIRDTLTGKEFDTYAKVIVNAAGPF
CDSIRKMADKNARDMICPSSGVHIILPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAG
TTDSNTTITFLPEPHEDEIQFILDAISDYLNVKVRRTDVLSAWSGIRPLAMNPSAKNTES
ISRDHVVCEDLPGLITITGGKWTTYRSMAEDAVDAAIKSGKLTPTSGCVTNNLHIVGGEG
WDPASFTVLTQQYMRMKISYKGKVVPGVMDTASAKHLSHAYGTLAERVAAIAQDECLGKR
LAHGYPFLEAEVAYCARHEYCESAIDFIARRSRLAFLDTDAAGRALPRVIQILAAEHKWD
KSRQKQELQKAKEFLETFKSSKNAQFHDGKHN
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgactgccacagctcgtctgaggcgaatcggcaccgctgtcgtagcagccgtcgccact
gcatatggcggcacaatccttctcgttcctccagtctctgccaatgatcatggtggcggt
ggatcccaccttgccgccatccggcagaagatccacgaccctagcgccaccgttccatca
agagaagtccagcgttcgtcgcttatcgggaccagtccagctaacccccttgatgttctc
gtcattggtgggggcgccacgggttcgggcgtggcactggatgccgtgacacgtggactc
cgcgttggtctcgttgagagagaggatttctcttcgggaacttcctcccgctccactaag
ctcatacatggaggtgttcgttatttggagaaagccgtctttaagtttgattatggccaa
ctaaagttagtattccatgcactcgaggagcgtaaacaagttattgacaatgcaccccac
ctgtgcaatgctttgccttgcatgactccatgttttgactggtttgaagtagtgtactac
tggattggcttgaaaatgtatgacttgattgctggagcacgattattgcacttatcaaga
ttttactctacagaggagtctgttgagctctttcccactttggcaaaggagggaaaaggt
agaagactgagaggcactgttgtgtattacgatgggcaaatgaatgatgctagacttaat
gttggattggcttgcactgctgcattagctggtgcaacggtgctgaaccatgctgaagtt
gtatctttactgaaggatgatattggtgaacggataattggtgcacaaataagggacact
ttgaccggcaaagaatttgatacatatgcaaaagtaattgtgaatgcggctggcccattt
tgcgactccataaggaaaatggctgacaaaaatgcaagagatatgatttgtccaagtagc
ggcgtacatatcatactccctgattattattctcccgagggaatgggcctaattgttcct
aaaacaaaggatggccgtgttgttttcatgctaccatggctaggacgaacagtagctggg
actacagattctaacaccaccattacttttctccctgaaccacatgaagatgaaatacaa
ttcatacttgatgctatatctgattaccttaatgttaaagtccggcgcactgatgttctc
tctgcttggagtggcattcgcccattagcaatgaatccatcagcaaaaaatacagagagt
atctccagggatcatgttgtctgcgaggatctccctggtttgatcactatcactggtggc
aagtggaccacctatcgtagcatggcagaagatgctgtcgatgcagcaataaagtctggg
aagctgacccccaccagtggatgtgtgactaacaatctccatattgttggtggggaaggg
tgggatcctgcttcttttacagttcttactcaacaatatatgcgcatgaaaatatcatat
aagggtaaagttgttcctggggtaatggacactgcgtctgcaaagcatttgtctcatgca
tatggaacattggctgaacgagtggctgccattgctcaggatgaatgcttgggtaagcga
cttgctcatggttacccttttctggaggcggaggtggcatactgtgcacggcatgaatat
tgtgaatctgccattgatttcattgcaaggaggagtcgtcttgctttcctcgacactgat
gcagcaggacgggcattgcctcgagtgattcaaatattagcagcagagcacaaatgggat
aagtcaagacagaagcaggagctacagaaggctaaagaatttttggagacttttaaatcc
tccaaaaatgctcagttccatgacgggaaacataattag

DBGET integrated database retrieval system