KEGG   Arachis duranensis: 107476467Help
Entry
107476467         CDS       T04300                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
adu  Arachis duranensis
Pathway
adu03030  DNA replication
adu03410  Base excision repair
adu03420  Nucleotide excision repair
adu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:adu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107476467
   03410 Base excision repair
    107476467
   03420 Nucleotide excision repair
    107476467
   03430 Mismatch repair
    107476467
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:adu03032]
    107476467
   03400 DNA repair and recombination proteins [BR:adu03400]
    107476467
Enzymes [BR:adu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     107476467
    6.5.1.6  DNA ligase (ATP or NAD+)
     107476467
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     107476467
DNA replication proteins [BR:adu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    107476467
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     107476467
DNA repair and recombination proteins [BR:adu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     107476467
   NER (nucleotide excision repair)
    Other NER factors
     107476467
   MMR (mismatch exicision repair)
    Other MMR factors
     107476467
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DUF4820
Motif
Other DBs
NCBI-GeneID: 107476467
NCBI-ProteinID: XP_015951768
LinkDB All DBs
Position
A03
AA seq 837 aa AA seqDB search
MLAFRPCFFNPPLCRPISVKVLSFFAFPSSLSSHILSLPFPHRTMTKPPSAFDALMSGAR
AAAAAAAKKKKSEQSQQPTVSSPKKRKPSPSTLPTPTSTLNPNDPKPSETVPTPTSDPPK
QEPEKEGPPPTKTRHVSSSSALQELKKRIPQLKAKPSKFDPSSVACWEKGTPVPFSLLAL
ALEMISAEPGRIKMTDIVCNLMKTVIYSTPEDLVPLIYLFAKRVAPAHEGLELGIGETSI
IKALAEATGSTESKIKKQYQGEGDLGRVAKICRSSQSMMRKPEALTIRKVFNTFRLIAKE
SGRDSQKKKKNHIKALLVAATDCEPQYLICLLQGKLRIGVAEQTLLAALGQAAVQSEEHS
KPPDGIKSPLEEAVKIVKQVYSVLPVYDEIVSALLTHGVWKLPSTCNFTPGIPVGPMLSK
PTKGISDILNSLQDVEFTCEYKYDGERAQIHYMENGSVEIYSRNAERNTGKFPDVVAAIS
RLKKSTVSSFVLDCEIVGYDREKQTIRSFQDLTTRPRKNVSVDNIKVDVCIFAFDILYLN
GRVLLQDNLKIRREHLYASFEEETGVFQYATAITSNDIEEIQKFLDKAVASSCEGLIIKT
LSEDSTYEPSNRSHNWLKLKKDYLDNIGDSLDLVPIGAFYGRGKRTGVYGAFLLACYDYN
NEEFQSICKIGTGFTEDVLEQRSKSLGSQVIPGPKRYYQCGDKMKPDVWFEASEVWEVKA
ADLTISPVYRAAVGIVDSDKGISLRFPRLVRVRPDKTPEQASSSEQVAEMYNAQKAAQTK
EKEKEKNKQDGSESPKKQIGSESPKKQIGSEDKDEDEVADEDEDEDVDVDADEDEDK
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcattccggccatgcttcttcaatccaccactctgccgccccatttccgttaaa
gttctctcctttttcgcatttccttcttctctttcctctcacattctctctctccctttc
ccccatcgcacaatgaccaaaccaccctccgccttcgacgctctcatgtccggtgctcgc
gctgccgccgccgccgctgccaagaagaagaaatccgagcagtcgcagcaaccaactgtt
tcttctcccaagaaacgaaaaccttcaccctccactctccccactccaacctccacgcta
aaccctaacgaccccaaaccctccgaaaccgttcctacgccaacgagtgacccgcccaag
caagaaccggagaaagaaggccctcctccgaccaagactcgccacgtgtcttcttcatct
gccttgcaggagctgaagaagcgcattccgcagctgaaggcgaagccttcgaaattcgat
cctagctcagtggcttgttgggagaagggcacgcctgtgccgttctcgttgctggctttg
gcgcttgaaatgatttctgcggaacctggcagaatcaagatgacagatattgtgtgcaat
ttgatgaagactgtgatatactctacccctgaggatcttgtgcctctgatttatctcttc
gcgaagagggttgctccggcgcatgaagggctggaattgggaattggcgagacttcgatt
attaaggcacttgctgaggcaactggaagtactgaatccaaaatcaagaagcagtatcag
ggcgagggtgatttgggaagagttgccaagatatgccgttcatctcagtccatgatgcgg
aagcctgaggctctgactattaggaaagttttcaacaccttccgtcttattgccaaggaa
tctggaagagacagtcaaaagaagaaaaagaatcatataaaggcacttcttgttgctgca
actgactgcgaacctcaatatcttatctgtcttctacagggaaaattgcggattggtgtg
gctgagcaaactctcttagctgcattaggccaagcagcagtacagagtgaagaacattct
aaaccacctgatggcattaagtctcctttggaagaggctgtaaaaattgttaaacaagtc
tactctgttcttcctgtctacgacgaaatagtatctgcacttcttacgcatggtgtatgg
aaacttccatcaacatgtaattttactcctggtattccagttggacctatgctgtcaaaa
ccaacgaagggtatctctgatattctaaattcattgcaagatgtggagtttacttgtgaa
tacaagtatgatggagagcgtgcccagatacattacatggaaaatggttcagttgagatt
tatagtagaaatgctgagcggaatactgggaagtttcctgatgttgttgctgcaatttca
aggttaaagaaatcaactgtatcatcatttgttcttgattgtgaaattgttggatatgat
cgtgagaaacagaccatccgttccttccaggatcttactactcggcctcgtaaaaatgta
tctgtggataatataaaggttgacgtctgcatatttgcttttgatatactgtatcttaat
ggccgagtacttcttcaggataacctgaaaatccgtagagagcatctttatgcctctttt
gaagaagaaactggagtttttcagtatgcaacggcaataacatcaaatgacattgaggaa
attcagaaatttctcgacaaagctgttgcgtcaagctgtgagggattaatcattaaaact
ttaagtgaagattctacatatgaaccttccaatcggtcacacaattggctaaaactgaag
aaagattatctggataacataggggactcactagatttggtacctataggtgcattctac
ggacgtgggaaacgtacaggagtctatggtgcttttcttcttgcttgctatgactacaat
aacgaagaatttcaaagtatttgtaagattggaacgggatttactgaagacgtgctcgaa
cagcgttctaaaagtcttggttctcaagtgattcctgggccaaagcgatactatcaatgt
ggagataaaatgaagcctgatgtctggtttgaagctagtgaggtgtgggaggtgaaagct
gcagatttgaccattagcccagtttaccgagctgcagtgggcatagtagattcagataag
ggcatatctcttagattcccacggctagttcgagttcgacctgacaaaacacccgagcag
gcctcatcatctgagcaggttgctgagatgtataatgctcaaaaagccgctcaaactaaa
gaaaaagaaaaagaaaaaaacaaacaggatggtagtgagtcaccaaaaaaacagattggc
agtgagtcaccaaaaaaacagattggcagtgaagacaaagacgaagacgaagtcgcagat
gaagatgaagatgaagatgtagatgtagatgcagatgaagatgaagataagtga

DBGET integrated database retrieval system