KEGG   Arachis duranensis: 107481021Help
Entry
107481021         CDS       T04300                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
adu  Arachis duranensis
Pathway
adu00250  Alanine, aspartate and glutamate metabolism
adu00410  beta-Alanine metabolism
adu00430  Taurine and hypotaurine metabolism
adu00650  Butanoate metabolism
adu01100  Metabolic pathways
adu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:adu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    107481021
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107481021
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107481021
   00430 Taurine and hypotaurine metabolism
    107481021
Enzymes [BR:adu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     107481021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 107481021
NCBI-ProteinID: XP_015956707
LinkDB All DBs
Position
A03
AA seq 500 aa AA seqDB search
MVLSKTASESDVSVHSTFASRYVRTSLPRFKMPEESIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMAAINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDSETAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKEEGKAYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLRDGYYVMDPEKAVDLVDENTICVAAILGSTLNGEFEDVKRLNDLLIQKNNQTGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSKDDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYKNVMENCRDNMLVLKDGLEK
TGRFDIVSKDDGVPLVAFTLKDNSRFNEFQVSDLLRRFGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTLAERLVADVEKVLHELDMLPPKVVVVNGEEAATSANGKVKKTALETQREITA
VWKKFVLERKKLNDKMNGVC
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggttctgtcgaagacggcatctgagagcgacgtctcggttcactcaacgtttgcgtca
cgctatgtgaggacctcacttcccaggttcaagatgccggaggagtcgatccccaaggag
gcagcgtaccagataataaacgacgagctgatgttagacggaaatcctaggctgaacctg
gcgtcgtttgtgacgacgtggatggagccggagtgcgacaaactcataatggccgccatt
aacaagaactacgttgacatggatgagtaccctgtcaccactgagctccagaatcggtgt
gtaaacatgatagctcatctattcaatgcgccacttggagattcagaaactgccgttggt
gttgggacggttggatcatcggaggccataatgctggctggattggcattcaaaagaaaa
tggcagaacaaaaggaaagaagaaggtaaggcttatgacaagcccaacattgtgaccggt
gccaatgtccaggtttgctgggagaaattcgcaaggtactttgaggtggagttgaaggag
gtgaagctccgtgatggatactatgttatggaccctgaaaaggctgtggatttggttgat
gagaacaccatttgcgttgctgctattcttggttccaccctcaacggtgagtttgaagat
gtgaagcgcttaaatgatcttctcattcaaaagaataatcaaaccggctgggatactcct
attcatgttgatgctgccagtggtggattcattgctccgtttctatatcccgagcttgag
tgggacttccggttaccgctggtcaagagtatcaatgtcagcggccacaagtacggtcta
gtttacgccggaattggttgggttatctggagaagcaaggatgacctgcctgaggaactc
atcttccacatcaactatctcggagctgatcaacccactttcactcttaacttctccaaa
ggttccagtcaagtcattgctcaatactaccaactaattcgccttggttatgagggatat
aaaaatgtgatggaaaattgtagggacaacatgttagtgctcaaggatggacttgagaaa
acagggcgctttgacattgtttccaaggacgatggtgttcctttggtggccttcacactc
aaagacaacagccgcttcaatgaattccaagtctctgacttgctcaggcgctttggctgg
atagtgccggcatacaccatgcccccggatgcacagcatgttaccgttctccgcgtggtc
atccgggaggacttctccaggaccctcgcagagcgccttgtggctgatgtggagaaggtg
cttcacgagcttgatatgcttccccccaaggtggttgtggttaatggagaagaggcagca
acaagcgctaatggcaaggttaagaagactgctctggagacacagagggagatcactgca
gtttggaagaagtttgtactggaaaggaagaagctgaatgacaagatgaatggggtttgt
tga

DBGET integrated database retrieval system