KEGG   Arachis duranensis: 107483260Help
Entry
107483260         CDS       T04300                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
adu  Arachis duranensis
Pathway
adu00052  Galactose metabolism
adu00500  Starch and sucrose metabolism
adu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107483260
   00500 Starch and sucrose metabolism
    107483260
Enzymes [BR:adu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107483260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 107483260
NCBI-ProteinID: XP_015959376
LinkDB All DBs
Position
A04
AA seq 904 aa AA seqDB search
MTELLSFYKREKSLTLNTLTMLPLLLFLCIIFRHGVEASTPTEVVGYGYTISSVASDHFG
KSLTATLSLIKSSSLHGPDIPQLKLSASFENKDRLRVTITDSTHQRWEIPEEVIPRGSYY
PHCSLSTKQFPSKQEVKLSLTTANSDLIFSLHNTTPFGFTISRKSSKDILFDTSPDPSNP
STFIVFKDQYLQLSSSLPSERASLYGFGEHTKSSFKLQPNQTLTLWNADIASFNLDLNLY
GSHPFYMDVRKGSKDGRVKSGSTHGVLLLNSNGMDVVYGGDRITYKVIGGLFDLYFFAGS
SPELVMEQYTELIGRPAPMPYWSFGFHQCRWGYKNVSDLKGVVANYAKANIPLEVMWTDI
DYMDAYQDFTLDPINFPRDKMKTFVDTLHQNGQKYVLILDPGIHVNQTYATFVRGLEDDI
YIKRNGVNYLGQVWPGPVYYPDFLNPSSQKFWGTEVKLFRELLPFDGIWLDMNELSNFIT
SPPNPSSSLDNPPYKINNSGVMQQINYRTVPATSLHFGNITEYDSHNLYGLLESKATNKV
LKDISGKRPFILSRSTFVSSGKYTAHWTGDNAATWNDLAYSIPSILNFGIFGIPMVGADI
CGFSGNTTEELCRRWIQLGAFYPFTRDHSDNTSNRQELYLWDSVAESARKVLGLRYCLLP
YLYTLMYEAHTKGTPIARPLFFSFPEDVTTYDISSQFLLGKGVLVSPVLKPGAITVDAYF
PAGNWFDLFNFSNSVSAESGKYVTLDAPSDHINVHVGEGNILAMQGEALTTEAARKTRFH
LVVVVSSSKTSYGQVYLDDGETLDISGQNEPWTLVSFYGALQKNSVFVASNVTNGRFALE
QRWIIEKVTFLGIPKHKRISYMNGTGSLKMVVKTHNDDSSQFVTIQVSELSLLIGEEFKL
EIEI
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgactgaactattgtccttctacaaaagagaaaagtccctcacactcaacacactcact
atgcttcccttgttattgttcttgtgcatcatatttaggcatggagttgaagcttccaca
ccaacagaagtagttggatatggctacaccatctcaagtgtggccagtgatcactttggg
aagtcgttgactgctactcttagcctcatcaaatcttcttctctccatggacctgacatc
ccacaactcaaactctctgccagttttgagaacaaggataggctaagagtaacaataaca
gactctacccaccaaagatgggagatcccagaagaagtgattcctagaggttcctattac
cctcactgctctctcagcaccaaacaattcccttctaaacaagaagtaaaactatctctg
acaacagcaaactcagacctcatattcagcctccacaacaccaccccatttggcttcact
atctcgcgcaagtcctccaaggacatcctctttgatacctcaccagacccttccaaccct
tcaactttcattgtgttcaaggaccagtatcttcagctatcttcctcactcccaagtgaa
agagcctccctttacggttttggtgagcacacaaagagttccttcaagttgcaaccaaac
cagaccctcacactatggaatgcagatattgctagtttcaaccttgacttgaacctttat
ggctctcaccctttttacatggatgtaaggaaagggtctaaagatggaagagtgaagtct
gggagcacacatggggtgttgctgctaaatagcaatgggatggatgttgtatatggtggc
gaccgtataacttacaaggtgattggtggattgtttgatctttacttttttgctggatca
tcgcccgagctggtgatggagcagtacactgaactcattggaagacctgctcctatgcct
tattggtcttttggttttcatcagtgtagatggggctacaagaatgtaagtgatctcaag
ggtgtggttgccaactatgcaaaagcaaacataccccttgaagttatgtggacagatatc
gattacatggatgcatatcaagatttcacccttgatcctatcaactttccacgggataag
atgaaaacatttgttgatacccttcaccaaaatggccagaaatatgtgcttatcttggat
cctggtatccatgtgaatcaaacatatgcaacttttgtcagaggattggaggatgatata
tacatcaagagaaatggagtcaattaccttggtcaagtttggcctggaccagtttactac
cctgatttcttgaatccaagcagccaaaagttttggggtacagaagtcaaattatttaga
gagcttctcccatttgacggtatttggcttgacatgaatgagttgtctaatttcatcact
tctcccccgaatccatcgtctagtcttgacaaccctccctataaaattaataattccgga
gttatgcaacagatcaattacagaacagtcccggcaacatctttacattttggcaatatc
actgaatatgattcccataatttatatggactcttagaatccaaagcaaccaacaaggtt
ttaaaggatataagtggcaaaaggccattcattctcagtagatcaacttttgttagttct
ggcaagtacacagctcactggacaggagataatgctgccacatggaatgatttagcatac
tcaatcccttctattttaaattttggaatatttggaattccaatggttggagcagatata
tgtggcttttcgggaaatacaactgaagaactttgtaggcgctggatccagctgggggct
ttttatccctttacaagagatcattcggacaacacttccaataggcaagagctatatctt
tgggattcagttgctgaatcggctaggaaagtgctcggcctgcgctattgcctcctccct
tacctttacacactaatgtatgaggcacacacaaaagggacaccaattgcaagacccctt
ttcttttcatttcctgaggatgtcacaacatatgatataagttcacagtttcttctagga
aaaggggttttagtgtcacctgtactaaagccgggggctataacggttgatgcatacttc
cctgcaggaaactggtttgatctcttcaatttctcgaattcagtgagtgctgaatcagga
aaatatgttacccttgatgctccatctgatcacataaatgtgcatgttggtgaaggtaac
atcttggccatgcaaggagaggcattgacaacagaagccgcccggaagacccgatttcat
cttgtggtggttgttagtagcagcaaaactagctatggacaagtttatttggatgatggg
gagacacttgacatatcaggacagaatgagccatggacattggttagtttttatggtgca
ttgcagaaaaatagtgtttttgttgcatctaatgtcactaatggaagatttgccctggaa
caaagatggatcatagaaaaggtcactttcttgggaatacctaagcataagagaataagt
tatatgaatggaacaggttcactgaagatggttgtcaagactcacaatgatgactcctca
cagtttgttactatacaagtttcagaattgtcactgcttattggagaggaatttaagctt
gaaattgaaatataa

DBGET integrated database retrieval system