KEGG   Arachis duranensis: 107486927Help
Entry
107486927         CDS       T04300                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: DNA ligase 6-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
adu  Arachis duranensis
Pathway
adu03030  DNA replication
adu03410  Base excision repair
adu03420  Nucleotide excision repair
adu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:adu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107486927
   03410 Base excision repair
    107486927
   03420 Nucleotide excision repair
    107486927
   03430 Mismatch repair
    107486927
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:adu03032]
    107486927
   03400 DNA repair and recombination proteins [BR:adu03400]
    107486927
Enzymes [BR:adu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     107486927
    6.5.1.6  DNA ligase (ATP or NAD+)
     107486927
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     107486927
DNA replication proteins [BR:adu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    107486927
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     107486927
DNA repair and recombination proteins [BR:adu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     107486927
   NER (nucleotide excision repair)
    Other NER factors
     107486927
   MMR (mismatch excision repair)
    Other MMR factors
     107486927
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C Lactamase_B_2 RMMBL Gmx_para_CXXCG
Motif
Other DBs
NCBI-GeneID: 107486927
NCBI-ProteinID: XP_015962985
LinkDB All DBs
Position
A04
AA seq 1382 aa AA seqDB search
MDPQLKPQTLNSTSLFLAATTATTHSEQPPHSLSLTTVPSTVPRSKLIPNTRFLVDAFRH
ADTAFSVSYFLSHFHSDHYTGLSNSWSRGIVFCSATTASLLQRILGVPERFLVPLPLCQP
VEIDGAEVTLVDANHCPGAVQFLFKVPTKEEGKKFERYVHTGDFRFCNSMILEPAILDFV
GCDAVFLDTTYCNPKFVFPSQEESVDYVVSVVKRVISDCGGDGSGVLFLVATYVIGKEKI
LVELARRVKRKVHVDARKMEVLRVLGYGESGVFTEDSSESNIHVVGWNVLGETWPYFKPN
FVRMKEIMIERGYSKVVGFVPTGWTYEVKCNRFPVRSKDSFEIHLVPYSEHSNYEELREY
VKFLKPRRVVPTVGLDVEKSDSKHADKMRKYFALLVDETANKHEFLKGFHRATGDTDFLV
EKDVNDGQKPGKNMEEGIKPSELDGEESTIPDVAASVPSSTGEPCTEGVTLLTDEEKKKM
IEELGNCLPTWVTRSQMLELISISGSNVVEAASNFYERETEFHKQAFSCQTSSLVSKCSS
LNDIDSPSKACLNSSSTTKNIDVFPSQDSTKLTILKHTVLSQASSAKRNKSSGSKPNKKV
KVKAKSQSQSSDPKQSTITKFFSKVLPVKPSVAQSDRSELMIGVSPKAKNMLPDDVGNQY
KDEIDQFXTIIEKAKGDVNKALDIYYCNSGNLGEKEISVQAECKIDSSLEKNCVLHELKG
IPDTTMKRNHVTLPLEKYNPKEHACWKDGQPAPYLHLARTFSLLEDEKGKIKASSMICNT
FRSLLALSPADVLPAVYLCTNKIAADHEKMELNIGGSIVTAALEEACGTNRSKIREMYNK
FGDLGDVAQECRQTQRLLAPPTPLLIKDVFSALQKISLQTGHGSTSRKKGIIISLMRSCR
EKEIKFLVRTLVRNLRIGAMLRTVLPALAQAVVMNSFPTVQQEGTSENLKEKLQVLSVEI
VEAYNIIPNLDLIVPSLMNKGIDFSVSSLSMVPGIPIKPMLATITNGIPKALNLFQNKAF
TCEYKYDGQRAQIHRLIDGSIRVFSRNGDESTSRFPDLIDIIKEFCKPVASTFIIDAEVV
GIDRKNGIRIMSFQELSSRGKGSKDTLVTTESIKVDICIFVFDIMFANGEQLLGFPLRTR
RKYLKDLLCDEKPGYFEYAKEITIEADKACETCKTTLTKINAFLEDALRSSCEGIMVKTL
DVDAGYSPSKRSDKWLKVKRDYVEGLNDSLDLVPIGAWHGNGRKAGWYSPFLMACYNPET
EEYQSVCRVMSGFSDSFYKEMKEFFSEDNVLSKKPLYYRTAEEPDMWFCPQLVWEIRGAD
FTVSPVHHAAIGLIHPTRGISIRFPRFISRVLDRNPEECTTAADIVDLFNSQTRKMDVTA
ED
NT seq 4149 nt NT seq  +upstreamnt  +downstreamnt
atggatccacaactcaaaccccaaaccctaaactccaccagtttattccttgctgccaca
acagccaccactcattccgaacaaccaccacattcactctccctcaccaccgttccttcc
accgtaccacgctccaagctcatcccaaacactcgcttcctcgtcgacgccttccgccac
gccgacacagcattctccgtctcctacttcctctctcacttccactccgatcactacact
ggtctctccaattcttggtcccgcggcattgtcttctgctccgccaccaccgcctccctc
ctccaacgaatcctcggagtccccgaacgcttccttgtaccccttcccctttgccagccc
gttgaaatcgacggcgcggaggtcacgctggtcgacgcgaaccactgccctggcgcggtc
cagttcctattcaaggtcccaacaaaagaagaagggaagaaattcgagaggtatgttcac
actggcgatttcaggttttgtaattcaatgattttggagcctgcaattcttgatttcgtt
ggctgtgatgctgtgttcttggatactacttattgcaacccaaagtttgtgtttccttcg
caagaggagagtgttgattatgtggttagtgtagtcaagagggttattagtgattgtggt
ggtgatggtagtggtgttttgtttcttgttgctacttatgttattgggaaggaaaagatt
ttggttgaacttgcacggagagtgaagaggaaggtgcatgtggatgctaggaaaatggag
gtcttgagggtgcttgggtatggagagagtggtgtgtttaccgaggacagttcagagagt
aatattcatgttgttggctggaatgtattgggggagacatggccgtattttaagccgaat
ttcgtaaggatgaaggagattatgattgagagagggtactccaaggttgtgggatttgtg
ccaaccggatggacttatgaagtaaagtgcaataggttcccagtgaggtccaaggattcg
tttgagattcatctcgtgccgtatagcgagcattccaactacgaggagctcagggagtat
gtgaagtttttgaagccaaggcgtgttgttccgacagtgggtttggatgttgagaaaagc
gacagtaagcatgctgacaaaatgaggaagtattttgctttattggttgatgagacggcc
aacaagcatgaatttctaaagggatttcaccgtgccacaggcgacacagatttcttggtt
gagaaggatgttaatgatggtcagaagccaggaaaaaacatggaggaaggaatcaagcca
tctgagttggatggtgaggaaagtacaattccggatgttgctgctagtgtgccctcttct
accggggaaccgtgtacagaaggtgttaccttactaactgatgaagaaaaaaagaaaatg
attgaagaacttggtaattgtttgccgacatgggtcactcgaagccaaatgttagagctg
atcagcatctcagggagcaatgttgttgaagctgcttctaatttttatgaacgtgaaact
gaatttcacaagcaagcgttttcttgtcaaacttcttctttggtgtccaagtgcagctcg
ctaaatgacatagattctccttcaaaagcttgcctgaattcaagcagcactaccaaaaat
atcgatgtttttccaagccaggactctactaaactaactatcttgaagcatacagttcta
agtcaagcttcctctgccaaaaggaataaaagtagtggaagtaagccaaacaagaaagta
aaagtcaaagcaaagtcacagtcacaatcaagtgatccaaagcagtccaccataacaaaa
ttcttcagcaaagtattgcctgtgaagcctagtgttgctcagtctgatcgttctgaattg
atgattggcgtaagccctaaagccaaaaatatgttgccagatgatgttggaaatcagtac
aaggatgagattgatcagtttntaactataattgagaaggcaaaaggagatgtaaataag
gcattggatatatattactgtaattctggaaatcttggtgaaaaggaaatttcagttcaa
gcagagtgtaaaattgatagctctttagagaagaattgtgtgttacatgaattgaaaggt
attcctgacaccactatgaagagaaatcatgtaactctaccacttgagaaatacaatcct
aaagagcatgcgtgttggaaagatgggcagcctgcaccatatttacatcttgcacgaacc
ttcagccttctggaggatgagaaaggaaagattaaggcttcttcaatgatatgcaatacg
ttccgaagtttgctggccttgtctccagcagatgtgctgcctgctgtgtacctatgtaca
aacaaaattgcggcagaccatgaaaaaatggaactaaacattggtggaagtatagttact
gcagcacttgaagaggcatgcggaacaaatcgatccaaaataagggagatgtataacaaa
tttggcgatcttggtgatgttgctcaagagtgtcgtcaaacacagagattgcttgcacca
ccaacaccacttctgattaaggatgttttctctgcactgcaaaagataagtttacaaaca
ggccatggaagcacatctcggaagaaaggcattatcattagtctcatgcgttcctgtcgt
gagaaggagattaaatttcttgttcggaccttggtcaggaacttaaggattggggcaatg
cttagaactgttttacctgccttggctcaagctgttgttatgaattctttccctacagta
caacaagaaggaacttcagagaatttgaaggagaagcttcaggtcctttctgtggaaatt
gttgaagcatataacataattccgaatttggatctcatagttccatctctcatgaacaaa
ggaattgatttttcggtttcaagtttgtcaatggttcctggaattcctattaagcctatg
cttgcaacgatcaccaatggcattcccaaagcattgaacctatttcaaaataaggcattt
acttgtgaatataagtatgatggtcagcgagctcaaattcacagattaattgatggatca
attcgtgttttttcaagaaatggagatgaatcaacatcaagatttcctgatcttattgac
ataattaaggaattctgcaagcctgttgcatcgactttcataattgatgctgaagttgtt
ggtattgatagaaaaaatggaattaggattatgtctttccaggagctatcttcacgtggt
aaaggaagcaaagatactctagttactacagagagcataaaggtggatatttgcatattt
gtctttgatatcatgtttgcaaatggagagcagctattgggttttcctcttcgcacaaga
cggaaatatctaaaggatttgttatgtgatgaaaaaccagggtattttgaatatgcaaag
gaaataacaattgaagcagacaaggcttgcgaaacttgtaaaaccacattaaccaagata
aatgctttcttggaagatgctcttcgttcttcctgtgaaggaattatggtgaaaacattg
gatgtagatgctggttattctccgtcaaagcgttctgataaatggttaaaggtcaaacga
gattatgtcgaaggtttaaatgattctcttgatttggtgcccattggagcttggcatgga
aatggaaggaaggccggatggtatagtccatttctcatggcatgttataatcctgaaact
gaggaatatcaaagcgtgtgccgtgtgatgtctgggttctcagattcgttttacaaagag
atgaaagaattcttctctgaggacaacgtcttatccaaaaagccgctgtattatcgaaca
gcagaggagcccgacatgtggttttgtccgcaacttgtttgggagatacgaggtgcagac
ttcacggtgtcccctgttcatcatgcagcgatcggtttaattcatccgactcggggcatc
tcaatacggtttccgagatttattagccgtgtgttggataggaacccagaagagtgtact
acagcagcagatattgttgatttgtttaattctcagacaaggaagatggatgtcacagct
gaagattga

DBGET integrated database retrieval system