KEGG   Arachis duranensis: 107487854Help
Entry
107487854         CDS       T04300                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
adu  Arachis duranensis
Pathway
adu00020  Citrate cycle (TCA cycle)
adu00190  Oxidative phosphorylation
adu01100  Metabolic pathways
adu01110  Biosynthesis of secondary metabolites
adu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:adu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107487854
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    107487854
Enzymes [BR:adu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     107487854
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 107487854
NCBI-ProteinID: XP_015964026
LinkDB All DBs
Position
A05
AA seq 600 aa AA seqDB search
MWRCVARRLRVPPPSDGSTPNHSLRSHFSRFFSSGGNSSYTVVDHKYDAVVVGAGGAGLR
AAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGD
QDAIQXFGGQSLNFGKGGQAYRCACAADRTGHALLHTLYGQAMRHNTQFFVEYFALDLIM
NNDGSCQGVIALNLEDGTLHRFQAASTILATGGYGRAYFSATSAHTCTGDGNAMVARAGL
PLEDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSR
SMTMEIREGRGVGPLKDHIYLHLNHLPPDVLKERLPGISETAAIFAGVDVTKEPIPVLPT
VHYNMGGIPTNYHGEVVTIKGDDPDAVVPGLMAAGEAACASVHGANRLGANSLLDIVVFG
RACANRVAEIHRPGEKQKPLESDAGQKTIAWLDKLRNSNGSLPTAKIRLNMQRIMQNNAA
VFRTQDTLAEGCQLIDKAWESFHDVKLEDRSLIWNSDLIETIELENLLINACITMHSAEA
RKESRGAHAREDFTKRDDENWMKHTLGYWEKEKVRLDYRPVHMNTLDDEVESFPPKARVY
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgcgtcgctcgtcgacttcgtgttcctccaccctccgacggatccacacct
aatcactctcttagatctcacttttctagattcttctctagcggagggaactcgtcgtac
acggtggtggatcataagtatgatgctgttgtggtaggtgctggtggcgctgggttgaga
gctgctattggactttccgagcatggattcaacactgcttgcatcaccaagctcttccca
actcgttctcacactgttgcagctcagggcggtataaatgctgcattgggaaatatgact
gaagatgactggaggtggcacatgtatgacactgtcaagggaagtgattggctaggagat
caagatgccatccagtaatttggtggtcaaagcttgaactttggaaagggtggtcaggcc
taccgatgtgcatgtgccgctgatcgtactggacatgctttgttgcacactctttatggc
caggctatgagacataatacacagttttttgttgagtattttgcattggaccttataatg
aataatgacggaagttgccaaggagtaattgccttgaatttggaggacggaacattacat
cggtttcaagctgcttcaacaattttggcaacagggggttatggtagagcatatttttcc
gcaacctctgcacatacatgtactggagatggtaatgccatggttgcacgtgctggactc
cctctcgaggatttggagtttgtgcagtttcacccaacaggtatatatggagcaggttgc
cttatcacagaaggttcccggggtgaaggtggaattctaagaaatagtgaaggtgagcga
tttatggaacgatatgctcccactgcaaaggatcttgcatcaagagatgtagtttcaaga
tcaatgactatggagattcgggaaggtcgtggtgtaggacccttgaaagatcacatctat
ctccacttgaatcacttacccccagatgtgctcaaggagagacttcctggaatatcggaa
acagctgctatttttgctggtgtggatgttacaaaggaacccattcctgttttgcccact
gtgcattataacatgggtggtatacctacaaactatcatggagaggtggttaccattaaa
ggtgacgacccagatgcagtagttcctggattgatggctgctggagaagcagcttgtgcg
tcggtgcatggagccaataggcttggtgccaattcgcttctggatattgtagtttttggc
agagcttgtgcaaatagggttgcagaaatccataggccaggagaaaaacaaaaaccttta
gagagtgacgctggtcagaaaacaattgcctggctggacaagttgagaaattcaaatggt
tcattgccaacagcgaaaattaggttaaatatgcaacggataatgcaaaataatgctgct
gtattccgtacacaagacacattagcagaaggttgccaattaattgataaagcgtgggag
agcttccatgatgtcaagttggaggaccggagtttaatttggaactccgacctgattgag
actattgagttggaaaaccttttgattaatgcctgcatcacaatgcactcagctgaagcc
aggaaagaaagcagaggagctcatgcccgtgaggatttcacgaaaagagatgatgagaac
tggatgaaacacactttggggtattgggagaaggagaaggtccggttggactacaggccg
gtgcacatgaatacactagatgatgaggttgagtcattccctcccaaagctcgtgtgtat
taa

DBGET integrated database retrieval system