KEGG   Arachis duranensis: 107490169Help
Entry
107490169         CDS       T04300                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 3
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
adu  Arachis duranensis
Pathway
adu00010  Glycolysis / Gluconeogenesis
adu00030  Pentose phosphate pathway
adu00051  Fructose and mannose metabolism
adu00052  Galactose metabolism
adu01100  Metabolic pathways
adu01110  Biosynthesis of secondary metabolites
adu01200  Carbon metabolism
adu01230  Biosynthesis of amino acids
adu03018  RNA degradation
Module
adu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:adu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107490169
   00030 Pentose phosphate pathway
    107490169
   00051 Fructose and mannose metabolism
    107490169
   00052 Galactose metabolism
    107490169
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    107490169
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:adu01009]
    107490169
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:adu03019]
    107490169
Enzymes [BR:adu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     107490169
Protein phosphatases and associated proteins [BR:adu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107490169
Messenger RNA biogenesis [BR:adu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     107490169
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-GeneID: 107490169
NCBI-ProteinID: XP_015966428
LinkDB All DBs
Position
A05
AA seq 561 aa AA seqDB search
MGSVTVSNKKPQTTSLNNYNNLATAPAANKTESVTTNNNCNGWIGGEGASAMTSAPNPKP
KIVYGTAGYILEDVPHFTDYISDLPTYPNPLQDNPAYSVVKQYFVHVDDSVPQKVVVHKD
SERGVHFRRAGPRQKVYFESDEVKAAIVTCGGLCPGLNTVIRELVCGLHHMYGVKSVLGI
EGGYRGFYARNTINLTPKCVNDIHKRGGTVLGTSRGGHDTNKIVDSIQDRGINQVYIIGG
DGTQRGAAAIFEEVRRRGLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
AESVENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLFEYIEKRLKE
NGHMVIVIAEGAGQELMSEKMQTMNKQDASGNKLLQDVGLWISQEIKDHFAREKTMAITL
KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRINEN
RNHVVITDRMWARLLSSTNQPSFLGDKCHNKDNVEEEEPLNQLPNGDLSDDTLKVNITCC
KGGWQTRGRKGNKKRKKGHDE
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgggttcagttaccgttagtaacaaaaagcctcaaacaacttccctcaacaactataac
aacctcgcaaccgctcccgccgcgaacaaaacagaatctgttacgaccaataataactgt
aacgggtggatcggtggcgagggagcatcagcgatgacgtcagctcccaatcccaagcct
aagatagtttacggcactgcaggttacatcctcgaagacgttccgcatttcactgattat
atttctgatcttccaacatacccgaatcctttgcaagacaaccctgcttactctgtagtt
aagcaatatttcgtgcatgtcgatgacagtgttccgcagaaggttgttgttcacaaagat
agtgaacgaggagtgcattttaggcgtgccggacctaggcaaaaggtgtatttcgagtcg
gatgaagtcaaggccgctattgtcacttgcgggggactatgccctggtctcaacactgtc
attagagagctagtgtgtggcttacaccatatgtatggtgtgaagagtgtacttggaatt
gaaggaggatacaggggtttctatgctcgcaatacaattaatttaactcctaaatgtgtt
aatgatatacacaagcgtggtggaactgttcttggtacatcccgtggcggacatgatacc
aataagatagttgacagtatacaagatcgtggaatcaatcaggtttacattattggagga
gatggaactcagaggggtgcagctgcaatttttgaggaagttagaaggcgtggtctcaaa
gttgcagttgtaggaatccccaagactatagataatgatatcccggttattgacaagtcc
tttggcttcgacactgccgttgaagaggctcaacgagctataaatgcagcacatgtggaa
gctgagagtgttgagaacggtataggggttgtcaagctgatgggtcgctatagtggattt
atcgcaatgtatgctactcttgcgagtagagatgttgactgctgcttgattccagagtca
ccattctaccttgagggtcctggtggactttttgaatatatagagaaacgacttaaagaa
aatgggcacatggttattgttattgccgaaggtgcaggacaggaacttatgtctgagaaa
atgcaaaccatgaacaaacaggatgcttcaggaaacaagcttcttcaagatgttgggttg
tggatatcccaagagattaaggatcattttgcaagagagaagacgatggccataactctc
aaatatatagatccaacttacatgattcgagccattccaagcaatgcttctgataatgtg
tactgcacacttctcgctcaaagtgctgttcatggagcaatggcaggttacactggctat
acaagtggacttgtcaatggaagacaaacttatatacccttctatagaatcaatgagaac
cggaatcatgtagtgataactgatagaatgtgggctaggctgttatcttcgacgaatcaa
cccagctttttgggcgacaagtgtcacaacaaagacaacgttgaagaagaagaaccatta
aaccagttgccaaatggagatctttcagatgataccttgaaggtgaacatcacatgctgc
aaaggtggttggcaaactcgtggaagaaaggggaacaagaaaagaaaaaagggtcatgat
gaatag

DBGET integrated database retrieval system