KEGG   Arachis duranensis: 107490282Help
Entry
107490282         CDS       T04300                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein AIM1
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
adu  Arachis duranensis
Pathway
adu00071  Fatty acid degradation
adu00592  alpha-Linolenic acid metabolism
adu01100  Metabolic pathways
adu01110  Biosynthesis of secondary metabolites
adu01212  Fatty acid metabolism
Module
adu_M00087  beta-Oxidation
adu_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:adu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107490282
   00592 alpha-Linolenic acid metabolism
    107490282
Enzymes [BR:adu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     107490282
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     107490282
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     107490282
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 107490282
NCBI-ProteinID: XP_015966529
LinkDB All DBs
Position
A05
AA seq 727 aa AA seqDB search
MGSSVKVDFEVGNDGVAIITMCNPPVNALAIPIIMGLKERFQEVAKRNDVKAVVLTGKGG
RFSGGFDISVMQKVHQTGDASILPDVSVELLVNLIEDSKKPVVAAVQGLALGGGLELALG
CHARIAAPGSQLGLPELTLGIIPGFGGTQRLPRLVGLPKAIDMMLKSKPIKSEEGKKLGL
IDEIVSPEELLRVSRQWALEIGERRKPWIRTLHRTDKIGSLSEAREVLKTARQHVKKTAP
HLPQQQACLDVIEHGIVHGGYSGVLREAEVFKQLVLSDTAKGLIHVFFAQRAISKVPGVS
DIGLKPRNLKKVAVIGGGLMGSGIATALILSNIHVILKEVNSQYLEKGIKTIEGNVRGLV
TRGKLAKNKADGALLLLKGVLDYSEFKDVDMVIEAVIENVNLKQTIFSDLEKICPPHCIL
ATNTSTIDLNVIGAKTRSEDRIVGAHFFSFAYLIISIALEIVRTKKTSAQVILDLITVGK
IINKSPVVVGNCTGFAVNRTFFPYSQGAHLLVNLGVDIFRIDRLISSFGLPMGPFQLQDL
AGYGVAVAVSKEFDGSFRGRTYKSPLLDLMIKSGRNGKNNGKGYYIYEKGSKPKPDLSIL
PIVEESRRLANIMPGGKPISITDQEIVEMILFPVVNEACRVLDEGIVIRASDLDIACVLG
MSFPNYRGGVVFWADLVGAKHVYNSLKKWSELYGNFYKPSRYLEERAIQGIPLSAPASAT
PRSKARL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgggttcttccgtgaaggttgattttgaggttgggaatgatggggttgctatcatcact
atgtgcaaccctcccgttaatgccttggctattccaatcattatggggttgaaagagaga
tttcaggaggtagctaaaaggaatgatgtcaaagctgtagttttgactggcaaaggtgga
agattttctggtgggtttgacatcagtgttatgcagaaggttcaccaaactggtgatgct
tcaattctccctgatgtctctgtggaactgttggtcaacttaattgaagattcgaagaag
cctgttgttgcggcagtacaagggctcgctcttggaggtggcttagagcttgccctggga
tgccacgcccgcattgctgctccaggaagtcaactgggactgccagagctgacacttgga
atcattccaggatttggaggcacacaacgtcttcccaggcttgttgggcttcctaaagct
attgacatgatgctgaaatcgaagccaataaagtcagaagaagggaagaaactaggactt
atagatgaaattgtgtctcctgaggagttactcagggtttcccgacagtgggcacttgag
attggagagagacgtaagccttggattcgaacacttcataggaccgataaaattggttcc
ttgtctgaagcacgtgaggtgttgaaaactgccagacaacatgtcaagaagactgcaccg
catttgcctcagcagcaagcatgcttagatgtgattgagcatggaattgtccatggaggc
tatagtggagttctaagggaagcagaagtattcaagcaactagtcctatcagacaccgca
aaaggattaattcatgtcttctttgctcagcgtgcaatatcaaaggtgcctggtgtatct
gatattgggcttaagccgagaaatttgaaaaaggttgctgttattgggggaggtctaatg
ggttctggaattgctactgctctcattctaagcaacattcatgtcatactcaaggaagtc
aattctcaatatcttgagaaggggataaaaacgattgaaggtaatgttagaggcttagta
acaaggggaaagttggcaaaaaataaggccgatggagcattgttgctgcttaaaggtgtt
cttgattactcagaatttaaagatgtggacatggtcattgaggctgtaattgaaaatgtt
aatctcaaacaaactatatttagtgatcttgagaagatatgccctcctcattgcatcttg
gcaacaaacacttcgactattgatcttaacgtcattggtgctaagactagatctgaagat
cgcattgtgggggctcattttttcagttttgcatatttaattatctctattgccttggag
attgtacggaccaagaaaacttctgctcaagttattcttgatcttatcactgttggtaaa
atcataaataagtctccggttgtcgtgggcaactgcactggctttgcagtgaacagaaca
tttttcccatattcacaaggtgcccatttattggtcaatctgggcgtggatatcttcagg
atcgatagattgataagcagtttcggccttcccatgggtcctttccagcttcaggacttg
gctggctatggagtagctgtagccgtttccaaagaatttgacggttcatttcgtggtcgc
acatataaatctccactgcttgatcttatgatcaaaagtgggagaaatggcaaaaacaat
ggaaaaggatactatatttatgaaaagggtagcaagccaaaacccgatctttcaatacta
ccaattgttgaagagtcgagaagacttgccaatattatgcctggtggaaagcctatatct
attactgaccaagagattgtagagatgatcctctttccagtagtgaacgaggcatgccgt
gttttagatgaaggaatagttattcgagcatcagaccttgacattgcttgtgttcttggg
atgagcttcccaaattacaggggtggcgttgttttctgggcggacttggttggggcgaag
catgtatataacagcctaaagaaatggtcagaattatatggtaacttctataagccatca
aggtatctggaggaaagggcaattcagggcattcctttgagtgcacctgcttcagccact
ccaagatcaaaggcacgtctatga

DBGET integrated database retrieval system