KEGG   Arachis duranensis: 107490570Help
Entry
107490570         CDS       T04300                                 

Definition
(RefSeq) glutamate decarboxylase isoform X1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
adu  Arachis duranensis
Pathway
adu00250  Alanine, aspartate and glutamate metabolism
adu00410  beta-Alanine metabolism
adu00430  Taurine and hypotaurine metabolism
adu00650  Butanoate metabolism
adu01100  Metabolic pathways
adu01110  Biosynthesis of secondary metabolites
Module
adu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:adu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    107490570
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107490570
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107490570
   00430 Taurine and hypotaurine metabolism
    107490570
Enzymes [BR:adu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     107490570
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Met_gamma_lyase
Motif
Other DBs
NCBI-GeneID: 107490570
NCBI-ProteinID: XP_015966826
LinkDB All DBs
Position
A05
AA seq 501 aa AA seqDB search
MVITSAVTDPEEQTQSLHSTFASRYVRDPIPRFKMPEKCIPKDAAYQIINDELMLDGTPR
LNLASFVTTWMEPECDKLIMASLNKNYVDMDEYPVTTELQNRCVNMIAHLYHAPIGDDEA
AVGVGTVGSSEAIMLAGLAFKRKWQAKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVE
LKEVKLTEGYYVMDPVKAVEMVDENTICVAAILGSTLTGEFEDVKLLNELLTKKNKETGW
NTPIHVDAASGGFIAPFLYPCLEWDFRLPLVKSINVSGHKYGLVYPGVGWVVWRSKDDLP
EELVFHINYLGSDQPTFTLNFSKAGSSQIIAQYYQFIRLGTEGYKNIMENCRENARILRE
GIERTGRFNIISKDVGVPLVAFSLKDSSQHTVFEVSDHLRKFGWIVPAYTMPPDAQHIAV
LRVVIREDFSRGLAERLVSDIVKVVDLLDTLPSPLSTKKAHVVAVANNETSEKAKKSALE
TQKEIALYWKRLVDGKRVGAC
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcacctccgctgtcacagatcctgaagaacaaacacaaagcttgcactctact
tttgcttccagatatgttcgtgaccctattcccaggttcaagatgccagagaagtgtata
ccaaaggatgcagcatatcagatcataaacgatgagttgatgttggatggaacaccaagg
cttaacttggcatcttttgtgaccacttggatggagcctgagtgtgataagctcatcatg
gcttcgcttaacaagaactatgttgacatggatgagtatcctgtcaccactgagctccag
aataggtgcgttaatatgatagcacacctataccatgctcctatcggtgatgatgaggct
gcagtcggtgtcggaactgtcggatcatcagaggcaataatgttggcaggtctagctttt
aaaaggaaatggcaggcaaagagaaaagcagaaggcaaaccttatgataagcctaacata
gttaccggcgctaatgtgcaggtttgttgggagaagtttgcacggtatttcgaggttgag
cttaaggaagtgaaactcacagaaggatactatgtgatggaccctgtgaaagcagttgaa
atggttgatgagaacaccatctgtgtggcggcgattttggggtcgactctgaccggtgag
tttgaggatgtgaaacttcttaatgagcttcttactaaaaagaataaggagacaggatgg
aataccccgattcatgttgatgctgccagcggagggttcattgccccatttctctaccct
tgtcttgagtgggattttcgcttaccattagtgaagagcatcaatgttagtggtcataag
tatggtcttgtctatcccggtgtcggttgggttgtttggaggagtaaagatgacttgcca
gaggaacttgtttttcacataaactatctcggatcggatcagccaacatttaccctcaat
ttctccaaagcaggctctagtcaaattattgctcaatattaccaatttatacggcttggc
acagagggctacaaaaatatcatggagaactgcagggagaatgcaagaattctgagggag
ggaatcgagagaacaggccggttcaacatcatctccaaggatgttggcgtgccgcttgtt
gccttctctttgaaagacagcagccaacacacagtgtttgaggtgtcagaccatctgaga
aaatttggctggatagttccggcctacacaatgccgccagacgcgcagcacattgcagtc
ctccgggtggtgatcagggaggatttcagccggggattggcggagagactcgtgtccgac
atagtgaaagttgtggatctcttggacacacttccaagccctctatcaacaaaaaaggca
catgtggtagctgttgctaataatgagacaagtgagaaggctaagaagagtgcattagag
actcagaaagagattgccttgtattggaagaggcttgtggatggtaaaagagttggagca
tgttag

DBGET integrated database retrieval system