KEGG   Arachis duranensis: 107492082Help
Entry
107492082         CDS       T04300                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
adu  Arachis duranensis
Pathway
adu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:adu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107492082
Enzymes [BR:adu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     107492082
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 107492082
NCBI-ProteinID: XP_015968538
LinkDB All DBs
Position
A06
AA seq 152 aa AA seqDB search
MVKAVAVLSSSEGVSGTIHFSQEGNGPTTVTGNLAGLKPGLHGFHVHALGDTTNGCMSTG
PHFNPNNKEHGAPEDENRHAGDLGNVNVGDDGTVSFSISDSQIPLSGPNSIVGRAVVVHA
DPDDLGKGGHELSKSTGNAGGRVACGVIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgtggcagttcttagcagcagtgagggtgtcagtggaactattcacttc
tctcaggaaggaaatggtccaaccactgtgactggaaatcttgctggccttaagcctggt
cttcatgggttccatgtccatgcccttggagacaccacaaatggttgcatgtcaactgga
ccgcatttcaatcctaacaacaaggagcatggtgcccctgaagatgagaaccgccatgct
ggtgatttaggaaatgttaatgttggagatgatggaactgttagcttctccatttccgac
agtcagatccctcttagcggaccaaactccattgttggaagggctgttgttgtccatgct
gatcctgatgatcttgggaaaggtgggcatgagcttagcaaatccactggaaatgctggt
ggcagagtagcttgcggggttattggtttgcaaggctag

DBGET integrated database retrieval system